BYKdb

Annotate results for A0A0A7I7A4

A0A0A7I7A4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0A7I7A4
DOMAINtad1/139MTLMDLMRIIRKHLVTAAIVFVMVFAGVTAYTFLVPPKYTATAQAMATYNASQGDDAGIS
QQYTGGTYIAGQITSYTTLATTETVLEPVIKDLGLDTSVKSLAEQLTVTNPTDTAFVNIS
AEDGDAQQASDIANAVAVS
DOMAINcd273/461TSAQPSEGKTTTSINVAAALAEDGARVLLVDADLRHPSVAHHLGLEGSAGLAHVLSGQMS
PKDVVQNYWKPNLHILPAGKRPANAGVLLGSDTMRIMVEQALTQYDYVIIDTAPLSVSND
GIVFGRWAKGLVLVTGRGVCEKKELKEISESLHTAKVPVLGFIFNYADPKKTHSNSNYYY
YYYEDAPRK
SITEWalker A280/282GKT
SITEWalker A'300/307LLVDADLR
SITEWalker B380/386VIIDTAP
SITE-377/-379YDY
SITEY Cluster450/455YYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTLMDLMRIIRKHLVTAAIVFVMVFAGVTAYTFLVPPKYTATAQAMATYNASQGDDAGISQQYTGGTYIAGQITSYTTLA
MTLMDLMRIIRKHLVTAAIVFVMVFAGVTAYTFLVPPKYTATAQAMATYNASQGDDAGISQQYTGGTYIAGQITSYTTLA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TTETVLEPVIKDLGLDTSVKSLAEQLTVTNPTDTAFVNISAEDGDAQQASDIANAVAVSMQNVIQNDLYSAADKSPVKIS
TTETVLEPVIKDLGLDTSVKSLAEQLTVTNPTDTAFVNISAEDGDAQQASDIANAVAVS                     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVQRARVPESPSSPNKPLYLAVGVVAGLVLGVFAALLKDMLNTKVEETSDVRSLVGASSLGSVPQDNSLGEKRPVLVSQP


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NGPIAEEFRRIHTNIEFLQTDKVAGKGQLLVITSAQPSEGKTTTSINVAAALAEDGARVLLVDADLRHPSVAHHLGLEGS
                                TSAQPSEGKTTTSINVAAALAEDGARVLLVDADLRHPSVAHHLGLEGS
                                       GKT                 LLVDADLR             
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGLAHVLSGQMSPKDVVQNYWKPNLHILPAGKRPANAGVLLGSDTMRIMVEQALTQYDYVIIDTAPLSVSNDGIVFGRWA
AGLAHVLSGQMSPKDVVQNYWKPNLHILPAGKRPANAGVLLGSDTMRIMVEQALTQYDYVIIDTAPLSVSNDGIVFGRWA
                                                           VIIDTAP              
       410       420       430       440       450       460      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
KGLVLVTGRGVCEKKELKEISESLHTAKVPVLGFIFNYADPKKTHSNSNYYYYYYEDAPRKKSHKK
KGLVLVTGRGVCEKKELKEISESLHTAKVPVLGFIFNYADPKKTHSNSNYYYYYYEDAPRK     
                                                 YYYYYY           
© 1998-2019