BYKdb

Annotate results for A0A0A7M6J2

A0A0A7M6J2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A7M6J2
DOMAINcd41/227TSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMSGFFKPVTKITGLTDYLAGTT
DLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVRRSAVKKVKEQLEQTGTPFLGVILNKYDVVTEKYGEYGN
YRNYGRK
SITEWalker A48/50GKS
SITEWalker A'68/75VLVDADIR
SITEWalker B149/155VIVDCPP
SITE-60/-65YARSGY
SITE-145/-148YYDY
SITEY Cluster215/224YGEYGNYRNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
                                        TSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
                                               GKS                 VLVDADIR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GFFKPVTKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVI
GFFKPVTKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVI
                                                                    VIVDCPP     
       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
DAAIIAQKCDAMVAVVEAGNVRRSAVKKVKEQLEQTGTPFLGVILNKYDVVTEKYGEYGNYRNYGRK
DAAIIAQKCDAMVAVVEAGNVRRSAVKKVKEQLEQTGTPFLGVILNKYDVVTEKYGEYGNYRNYGRK
                                                      YGEYGNYRNY   
© 1998-2019