BYKdb

Annotate results for A0A0A8HNH3

A0A0A8HNH3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A8HNH3
DOMAINcd53/235TSARPSSGKSTVSANLAITYAQSNYRTLIIDADMRKPTQHFIFELSNKEGLSSLLSGQSS
GDIAIKQTHIDNLDVLTSGPVPPNPSEMLNSKAFRNVFESALDVYDFIVIDTPPVNSVTD
SQLVAKISKQVVLVIDVNNNNRKEIQRAKDLLEKSGANLLGVVLNKLKGKSDEYYAYYGA
EER
SITE-221/-223GKS
SITEWalker A'80/87LIIDADMR
SITEWalker B160/166IVIDTPP
SITE-72/-77YAQSNY
SITEY Cluster226/230YYAYY
SITEWalker A60/62GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFKSKKHKKTTTNKKKLIVDHTPKSPVSEQFRGIRTNISFSNVNDDLTSVVITSARPSSGKSTVSANLAITYAQSNYRTL
                                                    TSARPSSGKSTVSANLAITYAQSNYRTL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIDADMRKPTQHFIFELSNKEGLSSLLSGQSSGDIAIKQTHIDNLDVLTSGPVPPNPSEMLNSKAFRNVFESALDVYDFI
IIDADMRKPTQHFIFELSNKEGLSSLLSGQSSGDIAIKQTHIDNLDVLTSGPVPPNPSEMLNSKAFRNVFESALDVYDFI
IIDADMR                                                                        I
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
VIDTPPVNSVTDSQLVAKISKQVVLVIDVNNNNRKEIQRAKDLLEKSGANLLGVVLNKLKGKSDEYYAYYGAEER
VIDTPPVNSVTDSQLVAKISKQVVLVIDVNNNNRKEIQRAKDLLEKSGANLLGVVLNKLKGKSDEYYAYYGAEER
VIDTPP                                                           YYAYY     
© 1998-2019