BYKdb

Annotate results for A0A0A8J8L3

A0A0A8J8L3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A8J8L3
DOMAINcd293/482SGASPSVGKTFISTNLAATIALTGKKVLFIDADLRKGYVHKMFGHQNNKGLSDILSGQQD
MKNVISKLSGGEFDYISRGQVPPNPAELLMHPRFEQLLNWASKNYDLVILDTPPILAVTD
AAIIGQYAGTTLLVARFENNTAKEVAVSIKRFEQSGVQIKGCILNGIVKKASSYYGYGYN
HYGYSYDEKN
SITEWalker A300/302GKT
SITEWalker A'320/327LFIDADLR
SITEWalker B400/406VILDTPP
SITEY Cluster466/478YYGYGYNHYGYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DNPILISNILDNISQNYLSQNVARQAAQDAKSLEFLNQQLPKVRAELDQAEDKLNVYRKQKDSVDLSMEAKTVLDQIVNV


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DNQLNELTFREAEVSQLYTKEHPTYKALMEKQQTLQTEKIKLNKKVSAMPSTQQEVLRLSRDVESGRAVYLQLLNRQQEL


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NIAKSSAIGNVRIIDTAITEHKPVKPKKIIVIGLGFVLGFLLSIGLVFLRIFLRRGIESPEQLEEMGINVYASVPVSEWL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKQSSKNKLRKNESDKLLAIENPADLALEAIRSLRTSLHFAMMEAKNNILMISGASPSVGKTFISTNLAATIALTGKKVL
                                                    SGASPSVGKTFISTNLAATIALTGKKVL
                                                           GKT                 L
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FIDADLRKGYVHKMFGHQNNKGLSDILSGQQDMKNVISKLSGGEFDYISRGQVPPNPAELLMHPRFEQLLNWASKNYDLV
FIDADLRKGYVHKMFGHQNNKGLSDILSGQQDMKNVISKLSGGEFDYISRGQVPPNPAELLMHPRFEQLLNWASKNYDLV
FIDADLR                                                                        V
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILDTPPILAVTDAAIIGQYAGTTLLVARFENNTAKEVAVSIKRFEQSGVQIKGCILNGIVKKASSYYGYGYNHYGYSYDE
ILDTPPILAVTDAAIIGQYAGTTLLVARFENNTAKEVAVSIKRFEQSGVQIKGCILNGIVKKASSYYGYGYNHYGYSYDE
ILDTPP                                                           YYGYGYNHYGYSY  
    
....
KNKK
KN  

© 1998-2019