BYKdb

Annotate results for A0A0A8VVA9

A0A0A8VVA9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A8VVA9
DOMAINcd39/226TSSKQDEGKTTVVANMGVSFAALEGKKVLIIDADLRNPSIHRKFNLTNTYGLTEVLSGQK
DLKKAIQNTEVNNLQILTTGKMPPNPSEMLESKKMKEFAQTLQESYDYIFIDSPPIGVIT
DAGSIANYSDATVLVVGSGETDIEMAKITKLRLEKVKANIIGVVLNKYVGEDSNYGYYSY
CYEQNDGS
SITEWalker A46/48GKT
SITEWalker A'67/74LIIDADLR
SITEWalker B147/153IFIDSPP
SITE-144/-146YDY
SITEY Cluster213/220YGYYSYCY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNIVAFKEPKSPISEAYRSIRTNIQFSNIDKNIQTILFTSSKQDEGKTTVVANMGVSFAALEGKKVLIIDADLRNPSIHR
                                      TSSKQDEGKTTVVANMGVSFAALEGKKVLIIDADLRNPSIHR
                                             GKT                  LIIDADLR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KFNLTNTYGLTEVLSGQKDLKKAIQNTEVNNLQILTTGKMPPNPSEMLESKKMKEFAQTLQESYDYIFIDSPPIGVITDA
KFNLTNTYGLTEVLSGQKDLKKAIQNTEVNNLQILTTGKMPPNPSEMLESKKMKEFAQTLQESYDYIFIDSPPIGVITDA
                                                                  IFIDSPP       
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
GSIANYSDATVLVVGSGETDIEMAKITKLRLEKVKANIIGVVLNKYVGEDSNYGYYSYCYEQNDGSRSARHKKKNKK
GSIANYSDATVLVVGSGETDIEMAKITKLRLEKVKANIIGVVLNKYVGEDSNYGYYSYCYEQNDGS           
                                                    YGYYSYCY                 
© 1998-2019