BYKdb

Annotate results for A0A0A8WSG4

A0A0A8WSG4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0A8WSG4
DOMAINcd92/281TSAIAGEGKSITALNLALSLAQEMDHTVLLIDADLRKPSINNYLGINGDIGLAEVLEDRS
DLPSALKHTGVGKLVVLPAGRVTLNPVELFTSQRMVKLIQEIKHRYPDRFVVIDTPPILP
FAETRTISRLVDGVIFVVKERLASQSSIAEAIEALEGAKKIGIVYNEAEISVADDRYGHY
YNRYYQKQND
SITEWalker A99/101GKS
SITEWalker A'120/127LLIDADLR
SITEWalker B202/208VVIDTPP
SITEY Cluster268/276YGHYYNRYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRIEKALEKASQLRQRMPDVQPEPVEFPPSTSNVQASSEYPLQTVVTEISNPLLVSITDSSSPISEEYRKLKSLLVATA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KERDFANVIMVTSAIAGEGKSITALNLALSLAQEMDHTVLLIDADLRKPSINNYLGINGDIGLAEVLEDRSDLPSALKHT
           TSAIAGEGKSITALNLALSLAQEMDHTVLLIDADLRKPSINNYLGINGDIGLAEVLEDRSDLPSALKHT
                  GKS                  LLIDADLR                                 
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVGKLVVLPAGRVTLNPVELFTSQRMVKLIQEIKHRYPDRFVVIDTPPILPFAETRTISRLVDGVIFVVKERLASQSSIA
GVGKLVVLPAGRVTLNPVELFTSQRMVKLIQEIKHRYPDRFVVIDTPPILPFAETRTISRLVDGVIFVVKERLASQSSIA
                                         VVIDTPP                                
       250       260       270       280   
....:....|....:....|....:....|....:....|...
EAIEALEGAKKIGIVYNEAEISVADDRYGHYYNRYYQKQNDQK
EAIEALEGAKKIGIVYNEAEISVADDRYGHYYNRYYQKQND  
                           YGHYYNRYY       
© 1998-2019