BYKdb

Annotate results for A0A0B0BTJ4

A0A0B0BTJ4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0B0BTJ4
DOMAINtad18/267KSITLRDIFDFIVFNWYWFALSAIAFAGIGIVYALSRPDVYRSSAMVLIDEQYNRSSNSD
LTGFMPGRMMYRTNSGVEDELLIMGSRSIMERVVAELDANIVYATKSKLRYSYLTAESSP
LKLTADTIRYTFNIHIKSIEDADGSFKALLEYRLPGQKTTEKTITGAFGETIRDTVGVFR
LERAVATAGYNPKAANSLRIYVRPVRNAAEAYAKALHVAQAQKFSNIVNVSISDHNPQKA
AALTNKLIEV
DOMAINcd598/795TSSMPGEGKSFVSINLSLTLGIAGKRVLLVDLDLRKASLSEKISGRRQTKGLVNYLVKKE
ENLDNLISHNAMHNVDVLYVGVIPPNPAELLMGDRITQTFEELKQMYDYVVVDTPPIGLV
TDTMLINRIADLTVFSVRVGKSFKRNLVGINILNDRKTLRNMNVIITDIGAARRYTRETS
TYGYGYGYGYGYGYGNEK
SITEWalker A605/607GKS
SITEWalker A'625/632LLVDLDLR
SITEWalker B707/713VVVDTPP
SITE-704/-706YDY
SITE-737/-739GKS
SITEY Cluster779/791YGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTENNKDIIDGRKEEENKSITLRDIFDFIVFNWYWFALSAIAFAGIGIVYALSRPDVYRSSAMVLIDEQYNRSSNSDLTG
                 KSITLRDIFDFIVFNWYWFALSAIAFAGIGIVYALSRPDVYRSSAMVLIDEQYNRSSNSDLTG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FMPGRMMYRTNSGVEDELLIMGSRSIMERVVAELDANIVYATKSKLRYSYLTAESSPLKLTADTIRYTFNIHIKSIEDAD
FMPGRMMYRTNSGVEDELLIMGSRSIMERVVAELDANIVYATKSKLRYSYLTAESSPLKLTADTIRYTFNIHIKSIEDAD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSFKALLEYRLPGQKTTEKTITGAFGETIRDTVGVFRLERAVATAGYNPKAANSLRIYVRPVRNAAEAYAKALHVAQAQK
GSFKALLEYRLPGQKTTEKTITGAFGETIRDTVGVFRLERAVATAGYNPKAANSLRIYVRPVRNAAEAYAKALHVAQAQK

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FSNIVNVSISDHNPQKAAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEKFKSDNSAVDIISE
FSNIVNVSISDHNPQKAAALTNKLIEV                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TKLSLETSRQYEDDLLKTEIQLEMLSAIGDILNGKEEIGILPVNIGIENQALSNAINKYNELVLERMRLGTETSDDNPVI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REMNAQIISMQHSLKKSIENVANSLQIQNESLRQQLAQVSDKVSNIPYLERETVSIERNQEIKAALYTYLLNKREETALS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVATTPVAQVIDKALVNPIHVAPHRSMIVLLFFAIGLILPAIVIYLIEQLRVKVGSVSEVEDNIHVPIIGAIPSKTAGMH


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NDKIVSPNSRDVVTEAFRMVRTNLDFTMPQGGKVIMVTSSMPGEGKSFVSINLSLTLGIAGKRVLLVDLDLRKASLSEKI
                                     TSSMPGEGKSFVSINLSLTLGIAGKRVLLVDLDLRKASLSEKI
                                            GKS                 LLVDLDLR        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGRRQTKGLVNYLVKKEENLDNLISHNAMHNVDVLYVGVIPPNPAELLMGDRITQTFEELKQMYDYVVVDTPPIGLVTDT
SGRRQTKGLVNYLVKKEENLDNLISHNAMHNVDVLYVGVIPPNPAELLMGDRITQTFEELKQMYDYVVVDTPPIGLVTDT
                                                                  VVVDTPP       
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLINRIADLTVFSVRVGKSFKRNLVGINILNDRKTLRNMNVIITDIGAARRYTRETSTYGYGYGYGYGYGYGNEKKMTLK
MLINRIADLTVFSVRVGKSFKRNLVGINILNDRKTLRNMNVIITDIGAARRYTRETSTYGYGYGYGYGYGYGNEK     
                                                          YGYGYGYGYGYGY         
       810     
....:....|....:
TRFRLFWKNLKKRKE


© 1998-2019