BYKdb

Annotate results for A0A0B0D234

A0A0B0D234 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0B0D234
DOMAINcd44/223TSASPSEGKSITTANTAVVFAQQGKKVLLVDADLRKPTIHYTFRTDNTYGLSNYLVSERP
LSDLVRESHIDNLDLLPCGPIPPNPSELLGSKKMKKFINEAHQKYDMIIFDTPPVLAVTD
SQVLSAFVDGVLLVVRSKQTEQEAAIKAKEQLLQSKATILGVVLNDKDVKSSSYYYYYGK
SITEWalker A51/53GKS
SITEWalker A'71/78LLVDADLR
SITEWalker B151/157IIFDTPP
SITE-92/-97YGLSNY
SITEY Cluster217/221YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQTSARSLIANDNPKSPIAEQFRTIRTNLQFSSVDKELETMLVTSASPSEGKSITTANTAVVFAQQGKKVLLVDADLRKP
                                           TSASPSEGKSITTANTAVVFAQQGKKVLLVDADLRKP
                                                  GKS                 LLVDADLR  
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TIHYTFRTDNTYGLSNYLVSERPLSDLVRESHIDNLDLLPCGPIPPNPSELLGSKKMKKFINEAHQKYDMIIFDTPPVLA
TIHYTFRTDNTYGLSNYLVSERPLSDLVRESHIDNLDLLPCGPIPPNPSELLGSKKMKKFINEAHQKYDMIIFDTPPVLA
                                                                      IIFDTPP   
       170       180       190       200       210       220   
....:....|....:....|....:....|....:....|....:....|....:....|...
VTDSQVLSAFVDGVLLVVRSKQTEQEAAIKAKEQLLQSKATILGVVLNDKDVKSSSYYYYYGK
VTDSQVLSAFVDGVLLVVRSKQTEQEAAIKAKEQLLQSKATILGVVLNDKDVKSSSYYYYYGK
                                                        YYYYY  
© 1998-2019