BYKdb

Annotate results for A0A0B0HRS4

A0A0B0HRS4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0B0HRS4
DOMAINcd46/229TSSQAGEGKTTTICNLAVTYALEGKRVLLIDADLRKPSLHRIFSLSNDHGLSTLLTGNAN
MEDAIQETMVACLSLLPSGPVPANPSELIASATLQELLESVKQEYDMILVDTPPVLTATD
PVITSTLCDGVVMVVAVGRVKKDHLKKAKEQLDHVNARMLGIVLNRINRDDQQLFYMKHY
GAKG
SITEWalker A53/55GKT
SITEWalker A'73/80LLIDADLR
SITEWalker B153/159ILVDTPP
SITEY Cluster221/225YMKHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRRSINDRSLIVSANPMSPISEVYRLLRTKIHYLSKDHESSVVMVTSSQAGEGKTTTICNLAVTYALEGKRVLLIDADLR
                                             TSSQAGEGKTTTICNLAVTYALEGKRVLLIDADLR
                                                    GKT                 LLIDADLR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPSLHRIFSLSNDHGLSTLLTGNANMEDAIQETMVACLSLLPSGPVPANPSELIASATLQELLESVKQEYDMILVDTPPV
KPSLHRIFSLSNDHGLSTLLTGNANMEDAIQETMVACLSLLPSGPVPANPSELIASATLQELLESVKQEYDMILVDTPPV
                                                                        ILVDTPP 
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
LTATDPVITSTLCDGVVMVVAVGRVKKDHLKKAKEQLDHVNARMLGIVLNRINRDDQQLFYMKHYGAKG
LTATDPVITSTLCDGVVMVVAVGRVKKDHLKKAKEQLDHVNARMLGIVLNRINRDDQQLFYMKHYGAKG
                                                            YMKHY    
© 1998-2019