BYKdb

Annotate results for A0A0B0HS13

A0A0B0HS13 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0B0HS13
DOMAINcd47/231TSAGPEEGKSTVVGNLAVTYAQDNRNVLLIDADMRKPTVHRTFQLSNIAGLSSVLSRQFS
LDEAIQATEIPNFYVMTAGAIPPNPAEMLNSKSMAQLMAELREQFDVILIDTPPVLAVTD
AQLLASQSDGVLMVINTGKVKKEIALKAKETLQRVNARMLGVVLNNVKRKASEEYYYYYY
ASNDN
SITEWalker A54/56GKS
SITEWalker A'74/81LLIDADMR
SITEWalker B154/160ILIDTPP
SITEY Cluster221/226YYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRSQNNRRHLIVLTNPRSPISESYRTLRTNIDFSSVDQVTQVIMVTSAGPEEGKSTVVGNLAVTYAQDNRNVLLIDADM
                                              TSAGPEEGKSTVVGNLAVTYAQDNRNVLLIDADM
                                                     GKS                 LLIDADM
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPTVHRTFQLSNIAGLSSVLSRQFSLDEAIQATEIPNFYVMTAGAIPPNPAEMLNSKSMAQLMAELREQFDVILIDTPP
RKPTVHRTFQLSNIAGLSSVLSRQFSLDEAIQATEIPNFYVMTAGAIPPNPAEMLNSKSMAQLMAELREQFDVILIDTPP
R                                                                        ILIDTPP
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
VLAVTDAQLLASQSDGVLMVINTGKVKKEIALKAKETLQRVNARMLGVVLNNVKRKASEEYYYYYYASNDN
VLAVTDAQLLASQSDGVLMVINTGKVKKEIALKAKETLQRVNARMLGVVLNNVKRKASEEYYYYYYASNDN
                                                            YYYYYY     
© 1998-2019