BYKdb

Annotate results for A0A0B1ZG62

A0A0B1ZG62 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0B1ZG62
DOMAINtad20/196ISIDLKQIIAAVRRNLKWIALIVLGALVAGFILTLLIIPRYEATAQVLVEQNADTIIEGS
ELQDNSSQQWDAERFLNTQVDILNSRSLAKRVAQSAKLSENQSFYDAMDEEMPQVDDLDG
GVSNANALADLRLDTVVELLQENLHVDLPIDSRVIQITFRSTDPVMSANIANLYAEN
DOMAINcd539/730TSTNESEGKTTTAHAIAMDLARLGKSVLLIDGDLRRPTLHRRMPVKNAPGLTELLVGDAQ
FDDVLHHSSYDNLTYMTALPIPPEPSLLLGGDRFPSVIAQAQQRFDIVIVDSAPMLGLSD
TASIASHTDGVLFVVDASRFHRGAVKSALRRLGMVDARMLGAVVTKFDARAAGGDYSYYG
YNYYTYGAERPE
SITEWalker A546/548GKT
SITEWalker A'566/573LLIDGDLR
SITEWalker B646/652VIVDSAP
SITE-608/-613YDNLTY
SITE-562/-564GKS
SITEY Cluster714/724YSYYGYNYYTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVAGDEKVYDASSYEQDQFISIDLKQIIAAVRRNLKWIALIVLGALVAGFILTLLIIPRYEATAQVLVEQNADTIIEGSE
                   ISIDLKQIIAAVRRNLKWIALIVLGALVAGFILTLLIIPRYEATAQVLVEQNADTIIEGSE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQDNSSQQWDAERFLNTQVDILNSRSLAKRVAQSAKLSENQSFYDAMDEEMPQVDDLDGGVSNANALADLRLDTVVELLQ
LQDNSSQQWDAERFLNTQVDILNSRSLAKRVAQSAKLSENQSFYDAMDEEMPQVDDLDGGVSNANALADLRLDTVVELLQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENLHVDLPIDSRVIQITFRSTDPVMSANIANLYAENYLESNLKRKFESSAYARKFLSSQLEEARSKVEASERELNQYSRA
ENLHVDLPIDSRVIQITFRSTDPVMSANIANLYAEN                                            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGLIRVSGQGQNADRETTLSVTNNALIQVNGAAADATTERLAAQDRWDTIANQPVLSIPQVIQNLAIQDILQKKATLEAQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LANERSRHLEGYPSIRVLEAQINELNNRIATIGGNIKNSIYLDYRTALAREHSLKEQVAKLRDEAMGEQERGVGYAVLKR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAETDRALYDTLLERYNELSASAGSTSNNVTLVDRADIPREPSSPNLILNLLIAVLLGGVSALAFVLVREHLDDAIRSPD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVERKLGLSLLGLIPRVTDEEASSAAEDAKSTLSEAYHSLVANLRFSTPNGFPTVLAVTSTNESEGKTTTAHAIAMDLAR
                                                          TSTNESEGKTTTAHAIAMDLAR
                                                                 GKT            
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGKSVLLIDGDLRRPTLHRRMPVKNAPGLTELLVGDAQFDDVLHHSSYDNLTYMTALPIPPEPSLLLGGDRFPSVIAQAQ
LGKSVLLIDGDLRRPTLHRRMPVKNAPGLTELLVGDAQFDDVLHHSSYDNLTYMTALPIPPEPSLLLGGDRFPSVIAQAQ
     LLIDGDLR                                                                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRFDIVIVDSAPMLGLSDTASIASHTDGVLFVVDASRFHRGAVKSALRRLGMVDARMLGAVVTKFDARAAGGDYSYYGYN
QRFDIVIVDSAPMLGLSDTASIASHTDGVLFVVDASRFHRGAVKSALRRLGMVDARMLGAVVTKFDARAAGGDYSYYGYN
     VIVDSAP                                                             YSYYGYN
       730   
....:....|...
YYTYGAERPEVEA
YYTYGAERPE   
YYTY         

© 1998-2019