BYKdb

Annotate results for A0A0B1ZSF1

A0A0B1ZSF1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0B1ZSF1
DOMAINtad1/153MQVLRRRRVVILIVSLLMFGAAAAAYFMTPPRYTAVATVALERGAEDVVKVDQVVPDVVP
DSASVDTEVQVLRSPKLIGTVVDKLNLTRDPEFNPALKEGRSAPEDVERNWAISTILSHL
TVKRSGFSYAIDLQYEAGSPTTAAKVANTIAST
DOMAINcd502/691TSALPNEGKTTAALSLARSAAMAGKRTILVDCDLRRRVSNAESSSMSSAGLLALLYGESK
LHESIYVEPETGLHVLPRGSDEHHVQPFADSEAFSQLIAALRERFDFVVLDTPPVLTIDD
SRVIAAKADCVVLMVRWRKTPTRAAELALRKLEAVDANVIGTSLSMVDVTAQARIGYDDA
SYYYSAYKSY
SITEWalker A509/511GKT
SITEWalker A'529/536ILVDCDLR
SITEWalker B609/615VVLDTPP
SITEY Cluster678/692YDDASYYYSAYKSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQVLRRRRVVILIVSLLMFGAAAAAYFMTPPRYTAVATVALERGAEDVVKVDQVVPDVVPDSASVDTEVQVLRSPKLIGT
MQVLRRRRVVILIVSLLMFGAAAAAYFMTPPRYTAVATVALERGAEDVVKVDQVVPDVVPDSASVDTEVQVLRSPKLIGT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVDKLNLTRDPEFNPALKEGRSAPEDVERNWAISTILSHLTVKRSGFSYAIDLQYEAGSPTTAAKVANTIASTYIDQQVS
VVDKLNLTRDPEFNPALKEGRSAPEDVERNWAISTILSHLTVKRSGFSYAIDLQYEAGSPTTAAKVANTIAST       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKAGATARASDFLEGQLDKLRVQVEAAEAAVADYRARHGLFDLGQDSTVTQAELSSLNTQLAQARAQEAEARARLNTANA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLSRGGTGEELGEALDSPVVSQLRAQRAEVSGKVASLSQQFGPKYPELAKAREQLKDIDQQIAGEVKRIVANLSIQANAA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQRTASLNQSLQRAEGTLAVDNKSAVGLAELERKADSTRTLYQTFLDRYKQTLAQRGLERADSYIVAPARVPGSPTFPNV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVFGVIGLIAAVAVSTIVVAILQLLDRGVETTSALEKRLGVQVLGSIPDTKHLPELTDREDRSRPTQLVVDKPHSSFAES


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FRCMQTSINFNLRDLHPVVAITSALPNEGKTTAALSLARSAAMAGKRTILVDCDLRRRVSNAESSSMSSAGLLALLYGES
                     TSALPNEGKTTAALSLARSAAMAGKRTILVDCDLRRRVSNAESSSMSSAGLLALLYGES
                            GKT                 ILVDCDLR                        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLHESIYVEPETGLHVLPRGSDEHHVQPFADSEAFSQLIAALRERFDFVVLDTPPVLTIDDSRVIAAKADCVVLMVRWRK
KLHESIYVEPETGLHVLPRGSDEHHVQPFADSEAFSQLIAALRERFDFVVLDTPPVLTIDDSRVIAAKADCVVLMVRWRK
                                                VVLDTPP                         
       650       660       670       680       690   
....:....|....:....|....:....|....:....|....:....|...
TPTRAAELALRKLEAVDANVIGTSLSMVDVTAQARIGYDDASYYYSAYKSYYV
TPTRAAELALRKLEAVDANVIGTSLSMVDVTAQARIGYDDASYYYSAYKSY  
                                     YDDASYYYSAYKSYY 
© 1998-2019