BYKdb

Annotate results for A0A0B1ZUM9

A0A0B1ZUM9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0B1ZUM9
DOMAINtad28/176DRLDLDGSLVFFRRHAALILATMSAVLALALIGSLVMTKTYRAQARVMLTGNVSAAGQAD
PTQAGRAAISNQLVDTQVEIITSRDMVERVAKAMGLTDKRTPAEREALIDQLQSRVSAER
SGESYAITISYDADTPASAMNIANAFARE
DOMAINcd522/713TSALPDEGKTVISCCLSHVYAVSGMRTILIDCDLRRRGFSRLLGKESRGAGLLEVLNGSA
QLNFDHNDNETVFWTLPIAGDDEDGDHLLTGKPFEDLIENLRTQFDRIVLDLPPVLPIAY
TRVLAERADAVVVAARWRKTTAFALKAALRRLPSDQVHVAGVALSQVDLRQRAYFGKLDP
AFYYKQYQKYYA
SITEWalker A529/531GKT
SITEWalker A'549/556ILIDCDLR
SITEWalker B629/635IVLDLPP
SITEY Cluster704/712YYKQYQKYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSTNSLVPADARSRDIASLGDPVSNGRDRLDLDGSLVFFRRHAALILATMSAVLALALIGSLVMTKTYRAQARVMLTGNV
                           DRLDLDGSLVFFRRHAALILATMSAVLALALIGSLVMTKTYRAQARVMLTGNV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAAGQADPTQAGRAAISNQLVDTQVEIITSRDMVERVAKAMGLTDKRTPAEREALIDQLQSRVSAERSGESYAITISYDA
SAAGQADPTQAGRAAISNQLVDTQVEIITSRDMVERVAKAMGLTDKRTPAEREALIDQLQSRVSAERSGESYAITISYDA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTPASAMNIANAFAREYTQWELQLEQNQNSKTRKDVEAKLSRLRDQAQADTQALQNYRIANNLLSTSGTSLTEQEISNYE
DTPASAMNIANAFARE                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQVAVAKAQASEDQARLNTALAQLRSGSDGDDVGEALNSSVVSNLRAQEAQLAGQVANLSSRYGDNHPELIRVRSQLSQV


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNQIREEIARVISNLRAKADVSSQRLASLSATLGVARGKLSQNNEAMVGLSELQRNAEASQEIYETYLGSYKQLLAAEGS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERPNARVLSWASLPSAPVSPNLKLNFALAIVVGLGLGVLAAYIVEALFQGLTTPEEVENLTGQHFLASIPLLTSIPSRGA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRSKAIATVRDEPYGVFTEAFRALGASIDQRTNGKAQVVAVTSALPDEGKTVISCCLSHVYAVSGMRTILIDCDLRRRGF
                                         TSALPDEGKTVISCCLSHVYAVSGMRTILIDCDLRRRGF
                                                GKT                 ILIDCDLR    
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRLLGKESRGAGLLEVLNGSAQLNFDHNDNETVFWTLPIAGDDEDGDHLLTGKPFEDLIENLRTQFDRIVLDLPPVLPIA
SRLLGKESRGAGLLEVLNGSAQLNFDHNDNETVFWTLPIAGDDEDGDHLLTGKPFEDLIENLRTQFDRIVLDLPPVLPIA
                                                                    IVLDLPP     
       650       660       670       680       690       700       710   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
YTRVLAERADAVVVAARWRKTTAFALKAALRRLPSDQVHVAGVALSQVDLRQRAYFGKLDPAFYYKQYQKYYA
YTRVLAERADAVVVAARWRKTTAFALKAALRRLPSDQVHVAGVALSQVDLRQRAYFGKLDPAFYYKQYQKYYA
                                                               YYKQYQKYY 

© 1998-2019