BYKdb

Annotate results for A0A0B2AI85

A0A0B2AI85 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0B2AI85
DOMAINtad1/135MELRDYIRILRTGWVLVVVMALIGVAAASVFSILSKPQFKASAQVFVSTQSGGTVQDLVQ
GSTFTQQRVKTYAGLVTTPIVLLPVISNLHLSMTADDLAKSVTATAPLNTTLIEISATST
DPVQAANVANGISES
DOMAINcd266/453TSAIESEGKSSTASNLAIALDNLGHKVIVVDADLRRPKIATYMGLEGAVGLTDLLIGRAD
MEDAIQQWGRGNLHVLPAGSVPPNPSELLGSAAMHSLVARLENEFDYVLFDAPPLLPVTD
AAVLSKTAGGAIVVVAAGRTHRSQLSAAVTTLENVGVRLFGFVLTMLPAQGPHAYGYQTY
GYGPVYAQ
SITEWalker A273/275GKS
SITEWalker A'293/300IVVDADLR
SITEWalker B373/379VLFDAPP
SITEY Cluster440/451YGYQTYGYGPVY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELRDYIRILRTGWVLVVVMALIGVAAASVFSILSKPQFKASAQVFVSTQSGGTVQDLVQGSTFTQQRVKTYAGLVTTPI
MELRDYIRILRTGWVLVVVMALIGVAAASVFSILSKPQFKASAQVFVSTQSGGTVQDLVQGSTFTQQRVKTYAGLVTTPI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLPVISNLHLSMTADDLAKSVTATAPLNTTLIEISATSTDPVQAANVANGISESLTNVVQNIESTGTQSAQVKLTRVQE
VLLPVISNLHLSMTADDLAKSVTATAPLNTTLIEISATSTDPVQAANVANGISES                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEVPSAPVTPNVPINVALGLFVGLALGIGAAVLRHVLDNRIRSDSDVQAISPAPILGGITYDAKASKRPLIVQDDPRSPR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEAFRTLRTNLQFVDAGEGARSFVVTSAIESEGKSSTASNLAIALDNLGHKVIVVDADLRRPKIATYMGLEGAVGLTDLL
                         TSAIESEGKSSTASNLAIALDNLGHKVIVVDADLRRPKIATYMGLEGAVGLTDLL
                                GKS                 IVVDADLR                    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IGRADMEDAIQQWGRGNLHVLPAGSVPPNPSELLGSAAMHSLVARLENEFDYVLFDAPPLLPVTDAAVLSKTAGGAIVVV
IGRADMEDAIQQWGRGNLHVLPAGSVPPNPSELLGSAAMHSLVARLENEFDYVLFDAPPLLPVTDAAVLSKTAGGAIVVV
                                                    VLFDAPP                     
       410       420       430       440       450       460       470
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAGRTHRSQLSAAVTTLENVGVRLFGFVLTMLPAQGPHAYGYQTYGYGPVYAQDDVTVGKDSRRMMHRRG
AAGRTHRSQLSAAVTTLENVGVRLFGFVLTMLPAQGPHAYGYQTYGYGPVYAQ                 
                                       YGYQTYGYGPVY                   
© 1998-2019