BYKdb

Annotate results for A0A0B2BYC4

A0A0B2BYC4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0B2BYC4
DOMAINtad28/185VGALIGGIGGALRRRWKLAALVAAIVLALALAAIMTITPSYQAVSRVRVDPSLNPMEQEG
AQSVLNAEAIETETGLMSSRALAEAVVRDLELYRDPEFAGDAALAEGAPTPGLISSTVNA
VRRRTAIGRDQLSYIISLSFKSEEAEKAATIANSLVET
DOMAINcd533/721TSAIPGEGKTETALSYARLLAINSSRVLLVDCDLRNGRVSRRLPHRPEQGLVELLEGEVT
LDQAVSVDETSGLAILSVATAHFTSQDLFEGPAMAEMLSRARQEYEYVVLDLPPVLAVAD
ARTIARHADGVCVVVRWGHTKPHATMQAVDQLRNDGVTILGGAYTMVDPDAPVMAGGYFT
GSLYRSYFG
SITEWalker A540/542GKT
SITEWalker A'560/567LLVDCDLR
SITEWalker B640/646VVLDLPP
SITE-637/-639YEY
SITEY Cluster710/719YFTGSLYRSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MATTTDTFDGNDRAETPRTGNGRRPRTVGALIGGIGGALRRRWKLAALVAAIVLALALAAIMTITPSYQAVSRVRVDPSL
                           VGALIGGIGGALRRRWKLAALVAAIVLALALAAIMTITPSYQAVSRVRVDPSL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPMEQEGAQSVLNAEAIETETGLMSSRALAEAVVRDLELYRDPEFAGDAALAEGAPTPGLISSTVNAVRRRTAIGRDQLS
NPMEQEGAQSVLNAEAIETETGLMSSRALAEAVVRDLELYRDPEFAGDAALAEGAPTPGLISSTVNAVRRRTAIGRDQLS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YIISLSFKSEEAEKAATIANSLVETYIDLRVRSTSGTSERQAGFFRERLGELAGEVTAAESRLANYRASTGLPQTGSSGT
YIISLSFKSEEAEKAATIANSLVET                                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VADQQITTLSSQLASAEGEAASARSNAQVASAQLASGNVDAVAAVQGSNVIRDLRNQRAEILREKGEIETRYDSRHPEAI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVRDQLAEVDRQILGEGQRVVLSLQAQARASAAEVGALRGRMSSLEGQRATNTRASAEAERLERDAASARAQYDRMNELS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LESTQSTGAVITQVEVVDAAEPPVSPDGPPRALLAVLAVLVAGASGIGCALAVEMSRGGLRTIEDFEDELGLRLLASIPL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGRPGSRLKPRRGPDPADTIRADRATLYIEAIRNLRASISRAGGGRGKVVAFTSAIPGEGKTETALSYARLLAINSSRVL
                                                    TSAIPGEGKTETALSYARLLAINSSRVL
                                                           GKT                 L
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDCDLRNGRVSRRLPHRPEQGLVELLEGEVTLDQAVSVDETSGLAILSVATAHFTSQDLFEGPAMAEMLSRARQEYEYV
LVDCDLRNGRVSRRLPHRPEQGLVELLEGEVTLDQAVSVDETSGLAILSVATAHFTSQDLFEGPAMAEMLSRARQEYEYV
LVDCDLR                                                                        V
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLDLPPVLAVADARTIARHADGVCVVVRWGHTKPHATMQAVDQLRNDGVTILGGAYTMVDPDAPVMAGGYFTGSLYRSYF
VLDLPPVLAVADARTIARHADGVCVVVRWGHTKPHATMQAVDQLRNDGVTILGGAYTMVDPDAPVMAGGYFTGSLYRSYF
VLDLPP                                                               YFTGSLYRSY 
 
.
G
G

© 1998-2019