BYKdb

Annotate results for A0A0B2JJK1

A0A0B2JJK1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0B2JJK1
DOMAINtad13/196DVIDFSVYLKVIQRAKWRIIGFSVVVTLLTIMFALTLIPQYKASATLLIESEQSKAVSFE
EIYGLDTTKKEYYLTQFEILKSDSIGREVITKLNLEEHGDFIPKPSLMGEIKGYVKGLLP
FLNKNEERYLSGEEKADQKMLFLLSIYKSKLGIEPIRNTQLVNISFESSDSALAALVANT
IGEV
DOMAINcd541/732TSTSPGEGKTTTSSNLAISLAQMGKVLLIDGDLRKPTIAKRFEIPVYHPGLTNLIVGTEE
LSECVHIDEKSGVVIMPSGQIPSNPLELLSNIKFTQLIGHLKTQYDHIIIDTPPTQAVSD
ALVIAQSADSVIYVVKSDVTRIKPIKAGLERLFEIKVHVAGVVLNQVDMSKSNDEHSYGY
YDYHDYSQKPEQ
SITEWalker A548/550GKT
SITEWalker A'567/574LLIDGDLR
SITEWalker B648/654IIIDTPP
SITEY Cluster718/726YGYYDYHDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNKFENNSIDNEDVIDFSVYLKVIQRAKWRIIGFSVVVTLLTIMFALTLIPQYKASATLLIESEQSKAVSFEEIYGLDTT
            DVIDFSVYLKVIQRAKWRIIGFSVVVTLLTIMFALTLIPQYKASATLLIESEQSKAVSFEEIYGLDTT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKEYYLTQFEILKSDSIGREVITKLNLEEHGDFIPKPSLMGEIKGYVKGLLPFLNKNEERYLSGEEKADQKMLFLLSIYK
KKEYYLTQFEILKSDSIGREVITKLNLEEHGDFIPKPSLMGEIKGYVKGLLPFLNKNEERYLSGEEKADQKMLFLLSIYK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKLGIEPIRNTQLVNISFESSDSALAALVANTIGEVYIDNQMRAKMGITQQASNWLNSRLSQLRIQLDDSEERLQDFRED
SKLGIEPIRNTQLVNISFESSDSALAALVANTIGEV                                            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QHLIDIEGIAGLATQELEQISAQLIEARNGKNKLESINRVIAEYGNNNLELLGSMPEITSHNVIQNVKRDVVTVERKLSE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSEVYGPKHPKIISASAELITVKNNLNKQIKGLITGIEKELNRVTRTVSALENDLSNIRARYQDITRKETQYNQLKREVE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TNRNIFNTFLSRSKETEVTSDFTSAAARFTDRAYAPNNPSKPNKKLIVVLAFVASFIFAIVMSLIFDALNDTVKTKPDVE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKLAQRMLGLLPQVSLPKKSVLPMHAYLDETYRRFAESVRTFRTSLLLTQLDKQHKIIAVTSTSPGEGKTTTSSNLAISL
                                                            TSTSPGEGKTTTSSNLAISL
                                                                   GKT          
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQMGKVLLIDGDLRKPTIAKRFEIPVYHPGLTNLIVGTEELSECVHIDEKSGVVIMPSGQIPSNPLELLSNIKFTQLIGH
AQMGKVLLIDGDLRKPTIAKRFEIPVYHPGLTNLIVGTEELSECVHIDEKSGVVIMPSGQIPSNPLELLSNIKFTQLIGH
      LLIDGDLR                                                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKTQYDHIIIDTPPTQAVSDALVIAQSADSVIYVVKSDVTRIKPIKAGLERLFEIKVHVAGVVLNQVDMSKSNDEHSYGY
LKTQYDHIIIDTPPTQAVSDALVIAQSADSVIYVVKSDVTRIKPIKAGLERLFEIKVHVAGVVLNQVDMSKSNDEHSYGY
       IIIDTPP                                                               YGY
       730     
....:....|....:
YDYHDYSQKPEQPTA
YDYHDYSQKPEQ   
YDYHDY         

© 1998-2019