BYKdb

Annotate results for A0A0B2XEX4

A0A0B2XEX4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0B2XEX4
DOMAINcd57/243TSAGPSQGKSTVSANVAVTWADQGVDVLLVDADMRRPTVHQTFQVPNKRGLTSLLTDETF
DLTNTIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIQELTKHFDLVIFDVPPVISVT
DAQILASKVDGTILVVPQGIVEKGSVAKAKELLEVVNARILGTIMNRVKAENTGGYYGGY
YGAEEIK
SITEWalker A64/66GKS
SITEWalker A'84/91LLVDADMR
SITEWalker B165/171VIFDVPP
SITEY Cluster232/237YYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLFKKEKSLDQASMKEGVGLITLTEPTSVIAEQFRTVRTNIQFSSIDQKLRSVVFTSAGPSQGKSTVSANVAVTWADQG
                                                        TSAGPSQGKSTVSANVAVTWADQG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDVLLVDADMRRPTVHQTFQVPNKRGLTSLLTDETFDLTNTIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIQELTK
VDVLLVDADMRRPTVHQTFQVPNKRGLTSLLTDETFDLTNTIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIQELTK
   LLVDADMR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HFDLVIFDVPPVISVTDAQILASKVDGTILVVPQGIVEKGSVAKAKELLEVVNARILGTIMNRVKAENTGGYYGGYYGAE
HFDLVIFDVPPVISVTDAQILASKVDGTILVVPQGIVEKGSVAKAKELLEVVNARILGTIMNRVKAENTGGYYGGYYGAE
    VIFDVPP                                                            YYGGYY   
   
...
EIK
EIK

© 1998-2019