BYKdb

Annotate results for A0A0B3RZC9

A0A0B3RZC9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0B3RZC9
DOMAINcd286/470TSPGKECGKTFTAANLAISLSRQENCRTLLLDLDMRRPSLHRILGVSDPGSLGDMLRGMT
APGDHLLRMGRNPVNAGRNIAFGLNGRPEAYASELLQDPRAESCLQRIEDEFDPDVVLID
LPPALSYDDVIAARPLFDGVLLVIGGGMTTEKEIAEVERRLGDGTPILGMILNKAEGTEL
DRYSY
SITEWalker A293/295GKT
SITEWalker A'314/321LLLDLDMR
SITEWalker B402/408VLIDLPP
SITEY Cluster468/470YSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNMMDSPKFRRKRTSATGSARPVSEPPDPVRPLDETAREAARKRDAAAEQARSEAEARRIAEAADKAKAREKAQEKLRRR


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AELEELARAEALRRVMAARARREAEARKAAERAEAEAALQAEKEAEERRIQAERADEERAAEARRKAAEEKAEAERLAEE


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKRAEQVRLAEARAAEDAARRAEEERLARERAEATETVPPLALTGMVPVTEQPASAPASARAPQEPDPVDSAWARLAEMT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDKGHLDRNRIITASRDDPAHAAFDVLRTRLLQALHENGWRRVAITSPGKECGKTFTAANLAISLSRQENCRTLLLDLDM
                                             TSPGKECGKTFTAANLAISLSRQENCRTLLLDLDM
                                                    GKT                  LLLDLDM
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRPSLHRILGVSDPGSLGDMLRGMTAPGDHLLRMGRNPVNAGRNIAFGLNGRPEAYASELLQDPRAESCLQRIEDEFDPD
RRPSLHRILGVSDPGSLGDMLRGMTAPGDHLLRMGRNPVNAGRNIAFGLNGRPEAYASELLQDPRAESCLQRIEDEFDPD
R                                                                               
       410       420       430       440       450       460       470
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVLIDLPPALSYDDVIAARPLFDGVLLVIGGGMTTEKEIAEVERRLGDGTPILGMILNKAEGTELDRYSY
VVLIDLPPALSYDDVIAARPLFDGVLLVIGGGMTTEKEIAEVERRLGDGTPILGMILNKAEGTELDRYSY
 VLIDLPP                                                           YSY
© 1998-2019