BYKdb

Annotate results for A0A0B3VM38

A0A0B3VM38 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0B3VM38
DOMAINcd35/222TSAEMDEGKTTTVCSIAKCFSDLENHRILLIDCDFRKKSVAKTLEIENKKGIADMTMNDM
DRKECIKKVEGFDVLTCGVSPSNSSVLLESKKFRDIIESLKGDYDYIFIDSPPLGRLNDA
AILARYLDGTIIVNASEYIDQQMAKVTRDKLEKVNANVIGVILNKFKAGDHKYYKYYGYY
KEEKGKKS
SITEWalker A42/44GKT
SITEWalker A'63/70LLIDCDFR
SITEWalker B141/147IFIDSPP
SITE-138/-140YDY
SITEY Cluster207/214YYKYYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLGLYDSGSFEINEAYREIRTNISLNTDIKTIVFTSAEMDEGKTTTVCSIAKCFSDLENHRILLIDCDFRKKSVAKTLEI
                                  TSAEMDEGKTTTVCSIAKCFSDLENHRILLIDCDFRKKSVAKTLEI
                                         GKT                  LLIDCDFR          
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENKKGIADMTMNDMDRKECIKKVEGFDVLTCGVSPSNSSVLLESKKFRDIIESLKGDYDYIFIDSPPLGRLNDAAILARY
ENKKGIADMTMNDMDRKECIKKVEGFDVLTCGVSPSNSSVLLESKKFRDIIESLKGDYDYIFIDSPPLGRLNDAAILARY
                                                            IFIDSPP             
       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDGTIIVNASEYIDQQMAKVTRDKLEKVNANVIGVILNKFKAGDHKYYKYYGYYKEEKGKKSFFKKRKRR
LDGTIIVNASEYIDQQMAKVTRDKLEKVNANVIGVILNKFKAGDHKYYKYYGYYKEEKGKKS        
                                              YYKYYGYY                
© 1998-2019