BYKdb

Annotate results for A0A0B4D7W4

A0A0B4D7W4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0B4D7W4
DOMAINtad12/148PGLDLADYLAILRVYWKAIVAFTLLATLAAAGWTVLQPKVYSSDSSGIVVTPGSDNVSLA
LAGDSLAKAKVKNYESVAKSRLVADRVIQSLDLKTSADALLGSITIKVPLDTAEIKVTAQ
STDPATAQRVADAWVNG
DOMAINcd299/485TSSMQAEGKSTVTANLAVTMAAAGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAE
LADVLQPWGALPNLSVLGSGRIPPNPSELLGSRAMKNMLTTLAKDAVVLIDAPPLLPVTD
AAVLSRVADGAIVVIRTGRTTQEQLDQSLGNLEKVKGRILGAVLNYVPTKGTDAYSYYGT
YTSAAAH
SITEWalker A306/308GKS
SITEWalker A'326/333VVVDGDLR
SITEWalker B406/412VLIDAPP
SITEY Cluster473/479YSYYGTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSTTTTPTEASPGLDLADYLAILRVYWKAIVAFTLLATLAAAGWTVLQPKVYSSDSSGIVVTPGSDNVSLALAGDSLAKA
           PGLDLADYLAILRVYWKAIVAFTLLATLAAAGWTVLQPKVYSSDSSGIVVTPGSDNVSLALAGDSLAKA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVKNYESVAKSRLVADRVIQSLDLKTSADALLGSITIKVPLDTAEIKVTAQSTDPATAQRVADAWVNGLAAQVEAIETAP
KVKNYESVAKSRLVADRVIQSLDLKTSADALLGSITIKVPLDTAEIKVTAQSTDPATAQRVADAWVNG            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AADTAGQAGAGQADAATAVRVLPLGKAVLPTSPTSPNTKLNLALGALVGLALGVAYALIRRHLDRRIRKAADIERLFGVP


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIGTLPVDHRLDGKSTIVDAGTAAQLHDAGGAMAEALRELRTNLSFLDVDQPPRIIVVTSSMQAEGKSTVTANLAVTMAA
                                                          TSSMQAEGKSTVTANLAVTMAA
                                                                 GKS            
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAELADVLQPWGALPNLSVLGSGRIPPNPSELLGSRAMKNMLTTL
AGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAELADVLQPWGALPNLSVLGSGRIPPNPSELLGSRAMKNMLTTL
     VVVDGDLR                                                                   
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKDAVVLIDAPPLLPVTDAAVLSRVADGAIVVIRTGRTTQEQLDQSLGNLEKVKGRILGAVLNYVPTKGTDAYSYYGTYT
AKDAVVLIDAPPLLPVTDAAVLSRVADGAIVVIRTGRTTQEQLDQSLGNLEKVKGRILGAVLNYVPTKGTDAYSYYGTYT
     VLIDAPP                                                            YSYYGTY 
       490       500       510      
....:....|....:....|....:....|....:.
SAAAHPQAEPEPLGEWPEPDALEVPEAIPGGRRARI
SAAAH                               

© 1998-2019