BYKdb

Annotate results for A0A0B4R738

A0A0B4R738 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0B4R738
DOMAINtad37/193GAVPLTHYLWLLKRHRWKMLAFVAATVAATVIVSSRLTPVYESTATVDVDRQTPTGVIGQ
EATRSVTNDADQFLATQVKLIQSDSVLRPVVERYGLRGRDGEVEESGGLAEERAAEAPVM
LKRLKVTRPPNTYLLLISYRSSEPRLAAQVANGIAQS
DOMAINcd549/738TSASPGEGKSTIAAHLAVAHAEQGHKTLLIDGDLRRPSVHRRFEIPSVLGLSNVLVAELP
WRDALVRLERLPELDILPAGPPSRRASDLVGRGLEQVLGEASFQYDLIILDAPPLLGFAE
PLQMATAVDGVVVVTRAGETSRKAVASVLATLGRLRATVVGLVLNEVHKEMSDSYYYYGH
YGKYYRTPSN
SITEWalker A556/558GKS
SITEWalker A'576/583LLIDGDLR
SITEWalker B656/662IILDAPP
SITEY Cluster723/733YYYYGHYGKYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAEHKSDHHLPAVAEAFPVTPYIPLAAPAADAEGEEGAVPLTHYLWLLKRHRWKMLAFVAATVAATVIVSSRLTPVYEST
                                    GAVPLTHYLWLLKRHRWKMLAFVAATVAATVIVSSRLTPVYEST

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATVDVDRQTPTGVIGQEATRSVTNDADQFLATQVKLIQSDSVLRPVVERYGLRGRDGEVEESGGLAEERAAEAPVMLKRL
ATVDVDRQTPTGVIGQEATRSVTNDADQFLATQVKLIQSDSVLRPVVERYGLRGRDGEVEESGGLAEERAAEAPVMLKRL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVTRPPNTYLLLISYRSSEPRLAAQVANGIAQSYLEHTYHIRYRSSLGLSSFMEKQLDELKAKMERSSGALMAFERELNV
KVTRPPNTYLLLISYRSSEPRLAAQVANGIAQS                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
INPEEKTSILSSRLLQLNTEYTSAQADRVRKEAAAASVKGGTLAAAQVSSQGESLRKLTERRDETQERFAEVKTHYGAGH


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PEYRKAAAQLGEVERLLEETRSNIGQRVEIEYRQSAERERMLARAVGETKAEFDRLNARSFEYQALKREAEADKQLYEEL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRKIKEAGINASFQNSSIRIADAARPALKPVFPNLKLNVLLALLLSTLAAVGAAVVSDVLDNTVRDPEQVARLLRTEVIG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLPVVKNWRGRLGPVATNGNGNGNGHGMALAPVEAAAHTLTGYDEAIRTLRNSILLTDFDRRLRSVLVTSASPGEGKSTI
                                                                    TSASPGEGKSTI
                                                                           GKS  
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAHLAVAHAEQGHKTLLIDGDLRRPSVHRRFEIPSVLGLSNVLVAELPWRDALVRLERLPELDILPAGPPSRRASDLVGR
AAHLAVAHAEQGHKTLLIDGDLRRPSVHRRFEIPSVLGLSNVLVAELPWRDALVRLERLPELDILPAGPPSRRASDLVGR
               LLIDGDLR                                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLEQVLGEASFQYDLIILDAPPLLGFAEPLQMATAVDGVVVVTRAGETSRKAVASVLATLGRLRATVVGLVLNEVHKEMS
GLEQVLGEASFQYDLIILDAPPLLGFAEPLQMATAVDGVVVVTRAGETSRKAVASVLATLGRLRATVVGLVLNEVHKEMS
               IILDAPP                                                          
       730         
....:....|....:....
DSYYYYGHYGKYYRTPSNA
DSYYYYGHYGKYYRTPSN 
  YYYYGHYGKYY      

© 1998-2019