BYKdb

Annotate results for A0A0B4RE18

A0A0B4RE18 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0B4RE18
DOMAINcd41/221TSASKEEGKSTTAANMAIVFAETGKRVLLIDADMRRPTLYRTFQLSNNTGLSNLLLGKGN
LKQSVKASGIPNLDLLMSGQIPPNPAELLESGILDELMAEMREVYDYVLFDSPPILSVTD
AKILANRCDGTVLVVNTGKSEKVSVEKARDSLATAKSFILGVVLNNYPLTSENYYYHNYS
E
SITE-178/-180GKS
SITEWalker A'68/75LLIDADMR
SITEWalker B148/154VLFDSPP
SITE-145/-147YDY
SITEY Cluster214/219YYYHNY
SITEWalker A48/50GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPRKLVVRTNPHSIAAEQYRTIRTNINFSIPELGSKIILFTSASKEEGKSTTAANMAIVFAETGKRVLLIDADMRRPTLY
                                        TSASKEEGKSTTAANMAIVFAETGKRVLLIDADMRRPTLY
                                               GKS                 LLIDADMR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTFQLSNNTGLSNLLLGKGNLKQSVKASGIPNLDLLMSGQIPPNPAELLESGILDELMAEMREVYDYVLFDSPPILSVTD
RTFQLSNNTGLSNLLLGKGNLKQSVKASGIPNLDLLMSGQIPPNPAELLESGILDELMAEMREVYDYVLFDSPPILSVTD
                                                                   VLFDSPP      
       170       180       190       200       210       220 
....:....|....:....|....:....|....:....|....:....|....:....|.
AKILANRCDGTVLVVNTGKSEKVSVEKARDSLATAKSFILGVVLNNYPLTSENYYYHNYSE
AKILANRCDGTVLVVNTGKSEKVSVEKARDSLATAKSFILGVVLNNYPLTSENYYYHNYSE
                                                     YYYHNY  
© 1998-2019