BYKdb

Annotate results for A0A0B4RE70

A0A0B4RE70 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0B4RE70
DOMAINcd51/233TSAAPSEGKSTTAANLAVVFAQEGKKVLLIDGDMRKPTTHYTFRMGNTIGLSSVLTRQSS
LQEVIRTTSVDRLDLMTCGPIPPNPAELLASKSMDTLIGQLKNMYDLIIFDAPPVLSVAD
GQILANKCEGTILVLSSGNTEKDMAIKAKEAIESSNSRLIGAVLNNFELPKDNYYYQYYG
NTE
SITEWalker A58/60GKS
SITEWalker A'78/85LLIDGDMR
SITEWalker B158/164IIFDAPP
SITEY Cluster224/229YYYQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARKKKVLQETARKLIAFTTPRSFVSEQFRTLRTNINFSSPDSEIHTMVITSAAPSEGKSTTAANLAVVFAQEGKKVLLI
                                                  TSAAPSEGKSTTAANLAVVFAQEGKKVLLI
                                                         GKS                 LLI
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGDMRKPTTHYTFRMGNTIGLSSVLTRQSSLQEVIRTTSVDRLDLMTCGPIPPNPAELLASKSMDTLIGQLKNMYDLIIF
DGDMRKPTTHYTFRMGNTIGLSSVLTRQSSLQEVIRTTSVDRLDLMTCGPIPPNPAELLASKSMDTLIGQLKNMYDLIIF
DGDMR                                                                        IIF
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
DAPPVLSVADGQILANKCEGTILVLSSGNTEKDMAIKAKEAIESSNSRLIGAVLNNFELPKDNYYYQYYGNTE
DAPPVLSVADGQILANKCEGTILVLSSGNTEKDMAIKAKEAIESSNSRLIGAVLNNFELPKDNYYYQYYGNTE
DAPP                                                           YYYQYY    
© 1998-2019