BYKdb

Annotate results for A0A0B4SBN9

A0A0B4SBN9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0B4SBN9
DOMAINcd51/227TSSLPKEGKSFTAANLAAVFAQQNKRVLLMDADLRKPAVHEYFDLSHHTGLTNVLLNNCS
LEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIVDSTPLLPVAD
AKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTSKLLGAMLNGKKEKKGRLYMY
SITE-188/-190GKT
SITEWalker A'78/85LLMDADLR
SITEWalker B158/164VIVDSTP
SITE-149/-155YEIEQQY
SITEY Cluster225/227YMY
SITEWalker A58/60GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQNKRVLLM
                                                  TSSLPKEGKSFTAANLAAVFAQQNKRVLLM
                                                         GKS                 LLM
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADLRKPAVHEYFDLSHHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DADLRKPAVHEYFDLSHHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DADLR                                                                        VIV
       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTSKLLGAMLNGKKEKKGRLYMY
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTSKLLGAMLNGKKEKKGRLYMY
DSTP                                                            YMY
© 1998-2019