BYKdb

Annotate results for A0A0B4XF30

A0A0B4XF30 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0B4XF30
DOMAINtad36/219RFIDVDRLIQIARRQAKLVVLFAAIGLMLGVTRLVFATYYYTAGTSVLIDDNLSRFAGDV
SPAPANMESDKKIMSQVAILRSSSLAAKVVDRQQLYEKREFINPPLSVTQQIKGLAKMAM
DVFAGMGAQMADADSLDARKGTAVAVLMENLRVEQQPQSFVIDLYYTSTDPTLSAQIANA
YAEA
DOMAINcd579/769VSVLPGEGKTTIAANFATLVASSPAKVLMIDADLRRGSLTQGLGIRFETGWTEALNGTTK
WQETLVVDPQTGVSLLATPRQVKVFNTSELISGPSMATLLQEARSMFDYIIVDLPPIGPV
FDAKAFEPFADGFLLVSEWGATPRALLKSTLEQEPAIAAKLLGVMLNKADQEKLSTYGGL
GSSEKLYSRYA
SITEWalker A586/588GKT
SITEWalker A'606/613LMIDADLR
SITEWalker B688/694IIVDLPP
SITEY Cluster765/772YSRYASYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNEFIGIGKAKMVQEAIRPYLGQRGTAKQPEAGDERFIDVDRLIQIARRQAKLVVLFAAIGLMLGVTRLVFATYYYTAGT
                                   RFIDVDRLIQIARRQAKLVVLFAAIGLMLGVTRLVFATYYYTAGT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVLIDDNLSRFAGDVSPAPANMESDKKIMSQVAILRSSSLAAKVVDRQQLYEKREFINPPLSVTQQIKGLAKMAMDVFAG
SVLIDDNLSRFAGDVSPAPANMESDKKIMSQVAILRSSSLAAKVVDRQQLYEKREFINPPLSVTQQIKGLAKMAMDVFAG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGAQMADADSLDARKGTAVAVLMENLRVEQQPQSFVIDLYYTSTDPTLSAQIANAYAEAYLSDKLDANFDASQRATVWLR
MGAQMADADSLDARKGTAVAVLMENLRVEQQPQSFVIDLYYTSTDPTLSAQIANAYAEA                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARLTDLKDQSQEAAMKVERYRTENGLTSAKGALLSEEQLSDISGQYILAQADSAKALALYNQYKAIVAAGQQTAVDNAAT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSEQQGSTVISTLRARYLTVIKRAQEIEGRFGPEHPQAITLRREQDDIGRQIFLELKQMTESYRNQYEVAVSREASLKEG


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSRITGQTSAANESLVQLKDLERNAEAISDLYKTYLTKYQETAQNQSFPISEARVISPASPPTEASSPKRTLTLGGSLIL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GAIFGIGLGLWREIREGTFRLGEEFTTLGLKFLGYLPPIPGATRPSPDDEGKLIANPDVETMRFAVKSGGTKFAETLRHA


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KIMTDTMLGSQNCKVIGVVSVLPGEGKTTIAANFATLVASSPAKVLMIDADLRRGSLTQGLGIRFETGWTEALNGTTKWQ
                  VSVLPGEGKTTIAANFATLVASSPAKVLMIDADLRRGSLTQGLGIRFETGWTEALNGTTKWQ
                         GKT                 LMIDADLR                           
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETLVVDPQTGVSLLATPRQVKVFNTSELISGPSMATLLQEARSMFDYIIVDLPPIGPVFDAKAFEPFADGFLLVSEWGAT
ETLVVDPQTGVSLLATPRQVKVFNTSELISGPSMATLLQEARSMFDYIIVDLPPIGPVFDAKAFEPFADGFLLVSEWGAT
                                               IIVDLPP                          
       730       740       750       760       770       780       790        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
PRALLKSTLEQEPAIAAKLLGVMLNKADQEKLSTYGGLGSSEKLYSRYASYYLEHGEPIMKARGRRRRKARVQLSKEL
PRALLKSTLEQEPAIAAKLLGVMLNKADQEKLSTYGGLGSSEKLYSRYA                             
                                            YSRYASYY                          

© 1998-2019