BYKdb

Annotate results for A0A0B5QHR5

A0A0B5QHR5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0B5QHR5
DOMAINcd55/242TSAQASEGKSTVSGNLALSFAQIDKKVVIVDCDLRKPSVHKNFKISNLVGLSEVITGQVN
LGDTVQKYNDNLYILPSGKIPPNPSEMLSSSAMAELIENLRDKYDIVILDSAPLGAVADA
QILSAKVDGTILVIKAQRTNKESVIEAKNFLNKVGANIIGVVLNSVETIKEKNYYYYETS
EEPRQVTE
SITEWalker A62/64GKS
SITEWalker A'82/89VIVDCDLR
SITEWalker B161/167VILDSAP
SITE-122/-127YNDNLY
SITEY Cluster228/231YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLMVRGLRKGIASQQYNGFIVEKKPRSMVSEAYKKLRTNIQYSSFDKEIKTIVVTSAQASEGKSTVSGNLALSFAQIDKK
                                                      TSAQASEGKSTVSGNLALSFAQIDKK
                                                             GKS                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVIVDCDLRKPSVHKNFKISNLVGLSEVITGQVNLGDTVQKYNDNLYILPSGKIPPNPSEMLSSSAMAELIENLRDKYDI
VVIVDCDLRKPSVHKNFKISNLVGLSEVITGQVNLGDTVQKYNDNLYILPSGKIPPNPSEMLSSSAMAELIENLRDKYDI
 VIVDCDLR                                                                       
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VILDSAPLGAVADAQILSAKVDGTILVIKAQRTNKESVIEAKNFLNKVGANIIGVVLNSVETIKEKNYYYYETSEEPRQV
VILDSAPLGAVADAQILSAKVDGTILVIKAQRTNKESVIEAKNFLNKVGANIIGVVLNSVETIKEKNYYYYETSEEPRQV
VILDSAP                                                            YYYY         
  
..
TE
TE

© 1998-2019