BYKdb

Annotate results for A0A0B6S2U1

A0A0B6S2U1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0B6S2U1
DOMAINtad12/267ELPDALGMIRLLRAHMWAIAGIAAAVVALAAVYVGLSTPLYSASAVIRVEAQGRNALGFA
ADGQQLVMGQGTARTDAEIGMLQSRSILDPVLNHYGYGITSSPHVLPILGAIARRFATPG
EPSRPWFGLDAYAWGGERLEVESMRVPPELENRKLRLRALEPGAFALIAPGGRVLLTGRV
GEPARADGVSIRVARLDARPNTEFDVTAWNDVNALQRFSRRLRIVEKGSGTGIVQISFDS
EDPARAAAVANAIAQG
DOMAINcd578/766TGPTPDTGKSFVAANLAVLEAETQKRVLLVDADMRCGRLASFFGKPNAGGLAELLAGRLG
LDQAIQPAGLAGLSLISCGTYPGNPSELLMVPAFRHLLDELKRRFDLLIIDTPPLLAVSD
AAIVANGGGRTVMVLRSGQHAEAEIEDTLIRLDRAGAWTVGAMFNAVPLRRGERHSYGYS
SACLNGDPV
SITEWalker A585/587GKS
SITEWalker A'605/612LLVDADMR
SITEWalker B685/691LIIDTPP
SITEY Cluster754/756YGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNARHPGDLPDELPDALGMIRLLRAHMWAIAGIAAAVVALAAVYVGLSTPLYSASAVIRVEAQGRNALGFAADGQQLVMG
           ELPDALGMIRLLRAHMWAIAGIAAAVVALAAVYVGLSTPLYSASAVIRVEAQGRNALGFAADGQQLVMG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QGTARTDAEIGMLQSRSILDPVLNHYGYGITSSPHVLPILGAIARRFATPGEPSRPWFGLDAYAWGGERLEVESMRVPPE
QGTARTDAEIGMLQSRSILDPVLNHYGYGITSSPHVLPILGAIARRFATPGEPSRPWFGLDAYAWGGERLEVESMRVPPE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LENRKLRLRALEPGAFALIAPGGRVLLTGRVGEPARADGVSIRVARLDARPNTEFDVTAWNDVNALQRFSRRLRIVEKGS
LENRKLRLRALEPGAFALIAPGGRVLLTGRVGEPARADGVSIRVARLDARPNTEFDVTAWNDVNALQRFSRRLRIVEKGS

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTGIVQISFDSEDPARAAAVANAIAQGYIAATIAESRANDGKTLDFINHELPRLRDELLQAEGALMGYQASAGSLQPTTE
GTGIVQISFDSEDPARAAAVANAIAQG                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQSYLQGGIDIERQIALLQLQRTQMTQNFTPDSAPMRNIDRQLAQLGAAKASFDARFVRMPGSERANADLSRNAKVAEGI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YIAMVNKGEELTVRRASTTGDVHIVDDAVRPADPVSPAIPIIMASSLGLGLALGGLFVLLRDRYLIGVTDSRFIERSMLI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PMLASVPYSPQQARLDQAMPRNLAFRPAESGLPRRPALLPAGTRAPAGEPLRSVSSQYLLARSFPHDVAVEALRGLRASL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLQVRDVQRPDDGMIVLTGPTPDTGKSFVAANLAVLEAETQKRVLLVDADMRCGRLASFFGKPNAGGLAELLAGRLGLDQ
                 TGPTPDTGKSFVAANLAVLEAETQKRVLLVDADMRCGRLASFFGKPNAGGLAELLAGRLGLDQ
                        GKS                 LLVDADMR                            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIQPAGLAGLSLISCGTYPGNPSELLMVPAFRHLLDELKRRFDLLIIDTPPLLAVSDAAIVANGGGRTVMVLRSGQHAEA
AIQPAGLAGLSLISCGTYPGNPSELLMVPAFRHLLDELKRRFDLLIIDTPPLLAVSDAAIVANGGGRTVMVLRSGQHAEA
                                            LIIDTPP                             
       730       740       750       760        
....:....|....:....|....:....|....:....|....:...
EIEDTLIRLDRAGAWTVGAMFNAVPLRRGERHSYGYSSACLNGDPVIA
EIEDTLIRLDRAGAWTVGAMFNAVPLRRGERHSYGYSSACLNGDPV  
                                 YGY            

© 1998-2019