BYKdb

Annotate results for A0A0B6WWQ6

A0A0B6WWQ6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0B6WWQ6
DOMAINtad39/254TQQIVAGYWRAVRRYLWLVIGLVALAAAATAIYMARQPDLYLARARVEIGSEEDSALSLS
PTGGPVVINRSSDPTYFSTQLQILTGSQLLRRVVRTLDLEHNPEFLRPRAVRDLSPWLNL
RRMLMLGTGQEKSAGQRGTRGQMPLPSEIAPATESQDDFDVAMRLDPYVRTIASSLKVDP
VKEVRLPVKETRLIDISFRHPDPYVAATVVNTIAET
DOMAINcd608/789ASSAEAEGKSTVAVNVALILAQTGAQVLLIDADMRRPKLHELFGLKNERGLSTLLSSEIR
NGDAFKCIHDSARGVQVLTSGPLAPHPAELLGSDQMRALLEELRARFDYIIVDSPPIAYF
TDGVVVATLVDGVMLVVRRGKSSRRIVRRTQKILHDVGARIFGVVFNHAGMPSDAAYYRY
NR
SITE-747/-749GKS
SITEWalker A'635/642LLIDADMR
SITEWalker B717/723IIVDSPP
SITEY Cluster784/787YYRY
SITEWalker A615/617GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMKGDPEKEPQSLIRLDASAPYPKLYADYDHRWEREERTQQIVAGYWRAVRRYLWLVIGLVALAAAATAIYMARQPDLYL
                                      TQQIVAGYWRAVRRYLWLVIGLVALAAAATAIYMARQPDLYL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARARVEIGSEEDSALSLSPTGGPVVINRSSDPTYFSTQLQILTGSQLLRRVVRTLDLEHNPEFLRPRAVRDLSPWLNLRR
ARARVEIGSEEDSALSLSPTGGPVVINRSSDPTYFSTQLQILTGSQLLRRVVRTLDLEHNPEFLRPRAVRDLSPWLNLRR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLMLGTGQEKSAGQRGTRGQMPLPSEIAPATESQDDFDVAMRLDPYVRTIASSLKVDPVKEVRLPVKETRLIDISFRHPD
MLMLGTGQEKSAGQRGTRGQMPLPSEIAPATESQDDFDVAMRLDPYVRTIASSLKVDPVKEVRLPVKETRLIDISFRHPD

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PYVAATVVNTIAETYKLSNLEKRTSARATTSQFLQRRIAELQAQIRAGEAQLLAYSKSHQILSLDPSQNTVVERLAGLNR
PYVAATVVNTIAET                                                                  

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLLDAENERKLAEAAYLASLEPGAAEAMVEKEDGISVAALNKLTELRQRRAQLLVEATEEMPEVKEVNEQIAELERQINE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARARAKDVMLTNLRTRYRQALAREEALRQAFDEQRGETLTQNEAAINYRIIQQEIETNKSLLDNLLQRAKENGMAMAGVA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NNIHIVEYAFPPNRPIGPARLQAVGLAIVLGLAVGIGLAIFLDYLDDSLQSAEEVERELHLPALAAIPTVSSRRSLSKAV


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALQTDGTAHPELLVGDGGESGLAETYRQLRTSVLLSTPGHAPKTLLVASSAEAEGKSTVAVNVALILAQTGAQVLLIDAD
                                               ASSAEAEGKSTVAVNVALILAQTGAQVLLIDAD
                                                      GKS                 LLIDAD
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRRPKLHELFGLKNERGLSTLLSSEIRNGDAFKCIHDSARGVQVLTSGPLAPHPAELLGSDQMRALLEELRARFDYIIVD
MRRPKLHELFGLKNERGLSTLLSSEIRNGDAFKCIHDSARGVQVLTSGPLAPHPAELLGSDQMRALLEELRARFDYIIVD
MR                                                                          IIVD
       730       740       750       760       770       780         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
SPPIAYFTDGVVVATLVDGVMLVVRRGKSSRRIVRRTQKILHDVGARIFGVVFNHAGMPSDAAYYRYNR
SPPIAYFTDGVVVATLVDGVMLVVRRGKSSRRIVRRTQKILHDVGARIFGVVFNHAGMPSDAAYYRYNR
SPP                                                            YYRY  

© 1998-2019