BYKdb

Annotate results for A0A0B6WXT1

A0A0B6WXT1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0B6WXT1
DOMAINtad33/229EQAHLREYWAIVYKRRWLILSLALAVTSLVAIYMYRQPNVYEAMVTIDIEPRRSVLQTKG
DVQVVSVPNDPNYWSTQIKLLQNPQLARQVALTLDLPNNPAFLSGQAGPSLTSSLRRILS
RRKKEENEQGKLQVVTDSEVDAENLTPEQLAKLEPYEEAILAGITVEPVEKTNLVNIKFQ
HSDPEMAAKVANTIADV
DOMAINcd582/772TSSQPSEGKTTTAVNMAMMLAQMGAEVLLLDCDLRRPRVHVHFNLANAKGVANYLAGERN
LDALMQTYAPLPNLKIMTSGPVPPSPAELLSSEEMRRLIDEASARFAHVIIDSPPAVSFT
DAAILSTMVDGVVLVVHGGHSSRAIVRRAKKLLQDVGAHIIGVVLNNVKLDAHDYQYYAN
YYAAYYDEEED
SITEWalker A589/591GKT
SITEWalker A'609/616LLLDCDLR
SITEWalker B690/696VIIDSPP
SITEY Cluster756/767YQYYANYYAAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQDNRLLPLSQTEQQLDRPLHDLTLGQPATFIEQAHLREYWAIVYKRRWLILSLALAVTSLVAIYMYRQPNVYEAMVTID
                                EQAHLREYWAIVYKRRWLILSLALAVTSLVAIYMYRQPNVYEAMVTID

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IEPRRSVLQTKGDVQVVSVPNDPNYWSTQIKLLQNPQLARQVALTLDLPNNPAFLSGQAGPSLTSSLRRILSRRKKEENE
IEPRRSVLQTKGDVQVVSVPNDPNYWSTQIKLLQNPQLARQVALTLDLPNNPAFLSGQAGPSLTSSLRRILSRRKKEENE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QGKLQVVTDSEVDAENLTPEQLAKLEPYEEAILAGITVEPVEKTNLVNIKFQHSDPEMAAKVANTIADVFIYNNLERETQ
QGKLQVVTDSEVDAENLTPEQLAKLEPYEEAILAGITVEPVEKTNLVNIKFQHSDPEMAAKVANTIADV           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GAQRASVLLAKQIAELQLKIRQGEEARINYLRSHNLPLGQAKGQNLTLERLATLSGQLLEAENERKNLQSAYEAAQRETD


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IWSVPEVQSDQRIQKLRDRIGELEEKRAALLVQYTPEWPEVKKVDEQIKRLKQDLDKAPYEVIKAMRSRYEAALARENKL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KQAYYQEAAAANEQNQAEIELSRITQELETNKQFYNTLFQRQKELEITSNDRANNITVATPARVPREPVGPKRLRNILIA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLVALGAGIGLAFLLDYLDDTLKSAEDVERYLHLPTLALIPAPRTERLLLKGKASEPEGVAEKTALALISDVRSPITEAY


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RHLRTQLLLSTAGQPPRTVLLTSSQPSEGKTTTAVNMAMMLAQMGAEVLLLDCDLRRPRVHVHFNLANAKGVANYLAGER
                     TSSQPSEGKTTTAVNMAMMLAQMGAEVLLLDCDLRRPRVHVHFNLANAKGVANYLAGER
                            GKT                 LLLDCDLR                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLDALMQTYAPLPNLKIMTSGPVPPSPAELLSSEEMRRLIDEASARFAHVIIDSPPAVSFTDAAILSTMVDGVVLVVHGG
NLDALMQTYAPLPNLKIMTSGPVPPSPAELLSSEEMRRLIDEASARFAHVIIDSPPAVSFTDAAILSTMVDGVVLVVHGG
                                                 VIIDSPP                        
       730       740       750       760       770       780      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
HSSRAIVRRAKKLLQDVGAHIIGVVLNNVKLDAHDYQYYANYYAAYYDEEEDERDLPEGAAERGAH
HSSRAIVRRAKKLLQDVGAHIIGVVLNNVKLDAHDYQYYANYYAAYYDEEED              
                                   YQYYANYYAAYY                   

© 1998-2019