BYKdb

Annotate results for A0A0B6X033

A0A0B6X033 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0B6X033
DOMAINcd147/335TSAGVLEGKTVTAINLAWLLAQTDGVRALLIDGDLRRPCALSYLGLDRRPGLSEVLAGEA
ELDATIVRLEPAGLYLLPGGSERNDVAEMLSGPRFSSVLAEVRRMFDYIVIDAPPLGIFT
DATVLINRADAALIVVRAGYTRYSLLDRLLEPLPRERLLGIVLNGVDETLDEHSYYYRRY
YRRAEEAKK
SITEWalker A154/156GKT
SITEWalker A'175/182LLIDGDLR
SITEWalker B255/261IVIDAPP
SITE-286/-289YTRY
SITEY Cluster321/327YYYRRYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGRVFDALRRAAELDSRKREHRARPSDAQARAEEIESLLQRSEIFSSQAREPQLFSASAEHADVATAIGSALPENGWASR


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAGATVDAERSARVASFPALDVSAARADQHLIAITQPQSPECEQFRSLRTHVLHAGEKRQVQAVVITSAGVLEGKTVTAI
                                                                  TSAGVLEGKTVTAI
                                                                         GKT    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLAWLLAQTDGVRALLIDGDLRRPCALSYLGLDRRPGLSEVLAGEAELDATIVRLEPAGLYLLPGGSERNDVAEMLSGPR
NLAWLLAQTDGVRALLIDGDLRRPCALSYLGLDRRPGLSEVLAGEAELDATIVRLEPAGLYLLPGGSERNDVAEMLSGPR
              LLIDGDLR                                                          
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FSSVLAEVRRMFDYIVIDAPPLGIFTDATVLINRADAALIVVRAGYTRYSLLDRLLEPLPRERLLGIVLNGVDETLDEHS
FSSVLAEVRRMFDYIVIDAPPLGIFTDATVLINRADAALIVVRAGYTRYSLLDRLLEPLPRERLLGIVLNGVDETLDEHS
              IVIDAPP                                                           
       330       340    
....:....|....:....|....
YYYRRYYRRAEEAKKKAVAEGVAV
YYYRRYYRRAEEAKK         
YYYRRYY                 
© 1998-2019