BYKdb

Annotate results for A0A0B8P2H5

A0A0B8P2H5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0B8P2H5
DOMAINcd359/545TGPSPAIGKSFVSANFASIIASAGQKVLLIDADMRKGHLGRGVKLDHDNGLSDYLVNDNE
INEVINSGQVENLDFIAKGKTPPNPSELLMHKRFTELCEWASENYDIVIIDTPPVLAVTD
AAIVGRQAGTTLMITRFAKTAPKEIEVSIDRLEQAGIETKGVILNAVEKTASSYYTYGYY
NYSYKSE
SITE-437/-439GKT
SITEWalker A'386/393LLIDADMR
SITEWalker B466/472VIIDTPP
SITEY Cluster532/542YYTYGYYNYSY
SITEWalker A366/368GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARSENGEFLLFVSQLVGKQGQEYGLGKRSKLDAIQWLNGSLSVSERGKQSGILSFGFEGENKAQIIDLLNDIANNYFLQ


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NVDRNAAEAENSLEFLQEKLPEIKAELTANEDALNKYRQDNESVDLGLEAQSTLKVMVELEAQLNELTFKESELAQRFTK


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QHPAYVAVLEKRKTLEAQKRRLEGQIKQLPKTQREVLRLTRDVEVNQQIYLQLLNKSQELAIVKASTVGNVRILDGAESY


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAPVKPKKPLIAVLATLLGGMLSVAFVLLRAAFHRGIENPDQIEELGIPVYATIPKSAQQEKIDRQLAKNRSRKKLVSAE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EMLLSSVNPADLSVEAFRSLRTSLHFAMMEAKNNIIMITGPSPAIGKSFVSANFASIIASAGQKVLLIDADMRKGHLGRG
                                      TGPSPAIGKSFVSANFASIIASAGQKVLLIDADMRKGHLGRG
                                             GKS                 LLIDADMR       
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VKLDHDNGLSDYLVNDNEINEVINSGQVENLDFIAKGKTPPNPSELLMHKRFTELCEWASENYDIVIIDTPPVLAVTDAA
VKLDHDNGLSDYLVNDNEINEVINSGQVENLDFIAKGKTPPNPSELLMHKRFTELCEWASENYDIVIIDTPPVLAVTDAA
                                                                 VIIDTPP        
       490       500       510       520       530       540     
....:....|....:....|....:....|....:....|....:....|....:....|....:
IVGRQAGTTLMITRFAKTAPKEIEVSIDRLEQAGIETKGVILNAVEKTASSYYTYGYYNYSYKSE
IVGRQAGTTLMITRFAKTAPKEIEVSIDRLEQAGIETKGVILNAVEKTASSYYTYGYYNYSYKSE
                                                   YYTYGYYNYSY   
© 1998-2019