BYKdb

Annotate results for A0A0B8PAG3

A0A0B8PAG3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0B8PAG3
DOMAINtad17/258DVIDLGKLLGLLLDGKWIIIFTTFVFAVIGVTYAILATPIYKADALVQVEQKTSGFPALS
EGLGEMFAQESQASTEIEIIKSRMVLGKTVDKFNLTIVASPKYLPVIGKGLAQRMGEEAF
IKVERFDIPDYALTGGYQITLDDPTTAAFSLTNSDDQLVLKGKVGELARSENGEFLLFVS
QLVGKQGQEYGLGKRSKLDAIQWLNGSLSVSERGKQSGILSFGFEGENKAQIIDLLNDIA
NN
DOMAINcd541/727TGPSPAIGKSFVSANFASIIASAGQKVLLIDADMRKGHLGRGVKLEHDNGLSDYLVNDKE
INEVIHSGQLENLDFIAKGKTPPNPSELLMHKRFTELCEWASENYDIVIIDTPPVLAVTD
AAIVGRQAGTTLMITRFAKTAPKEIEVSIDRLEQAGIETKGVILNAVEKTASSYYTYGYY
NYSYKSE
SITE-619/-621GKT
SITEWalker A'568/575LLIDADMR
SITEWalker B648/654VIIDTPP
SITEY Cluster714/724YYTYGYYNYSY
SITEWalker A548/550GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTQNNRPNRTQQPPQPDVIDLGKLLGLLLDGKWIIIFTTFVFAVIGVTYAILATPIYKADALVQVEQKTSGFPALSEGLG
                DVIDLGKLLGLLLDGKWIIIFTTFVFAVIGVTYAILATPIYKADALVQVEQKTSGFPALSEGLG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EMFAQESQASTEIEIIKSRMVLGKTVDKFNLTIVASPKYLPVIGKGLAQRMGEEAFIKVERFDIPDYALTGGYQITLDDP
EMFAQESQASTEIEIIKSRMVLGKTVDKFNLTIVASPKYLPVIGKGLAQRMGEEAFIKVERFDIPDYALTGGYQITLDDP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TTAAFSLTNSDDQLVLKGKVGELARSENGEFLLFVSQLVGKQGQEYGLGKRSKLDAIQWLNGSLSVSERGKQSGILSFGF
TTAAFSLTNSDDQLVLKGKVGELARSENGEFLLFVSQLVGKQGQEYGLGKRSKLDAIQWLNGSLSVSERGKQSGILSFGF

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EGENKAQIIDLLNDIANNYFLQNVDRNAAEAENSLEFLQEKLPEIKAELTANEDALNKYRQDNESVDLGLEAQSTLKVMV
EGENKAQIIDLLNDIANN                                                              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELEAQLNELTFKESELAQRFTKQHPAYVAVLEKRKTLEAQKRRLEGQIKQLPKTQREVLRLTRDVEVNQQIYLQLLNKSQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELAIVKASTVGNVRILDGAESYSAPVKPKKPLIAVLATLLGGMLSVAFVLLRAAFHRGIENPDQIEELGIPVYATIPKSA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQEKIDRQLAKNRSRKKLVHAEEMLLASINPADLSVEAFRSLRTSLHFAMMEAKNNVIMITGPSPAIGKSFVSANFASII
                                                            TGPSPAIGKSFVSANFASII
                                                                   GKS          
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASAGQKVLLIDADMRKGHLGRGVKLEHDNGLSDYLVNDKEINEVIHSGQLENLDFIAKGKTPPNPSELLMHKRFTELCEW
ASAGQKVLLIDADMRKGHLGRGVKLEHDNGLSDYLVNDKEINEVIHSGQLENLDFIAKGKTPPNPSELLMHKRFTELCEW
       LLIDADMR                                                                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASENYDIVIIDTPPVLAVTDAAIVGRQAGTTLMITRFAKTAPKEIEVSIDRLEQAGIETKGVILNAVEKTASSYYTYGYY
ASENYDIVIIDTPPVLAVTDAAIVGRQAGTTLMITRFAKTAPKEIEVSIDRLEQAGIETKGVILNAVEKTASSYYTYGYY
       VIIDTPP                                                           YYTYGYY
       
....:..
NYSYKSE
NYSYKSE
NYSY   

© 1998-2019