BYKdb

Annotate results for A0A0B8PTA8

A0A0B8PTA8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0B8PTA8
DOMAINcd161/347TGPSPAIGKSFVSANFASIIASAGQKVLLIDADMRKGHLGKGVKLEHSHGLSDYLVNDKE
IEGVINTGQIENLDIIVKGKTPPNPSELLMHKRFTELCEWASENYDIVIIDTPPVLAVTD
AAIVGRQAGTTLMITRFAKTAPKEIEVSIDRLEQAGVETKGVILNAVEKTASSYYTYGYY
NYSYKSE
SITE-239/-241GKT
SITEWalker A'188/195LLIDADMR
SITEWalker B268/274VIIDTPP
SITEY Cluster334/344YYTYGYYNYSY
SITEWalker A168/170GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTRDVEVNQQIYLQLLNKSQELAIVKASTVGNVRILDGAESYSAPVKPKKPLIAVLATLLGGMLSVAFVLLRAAFHRGIE


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPEQIEELGIPVYATIPKSAQQEKIDRQLAKSRSRKKLVHAEEMLLASVNPADLSVEAFRSLRTSLHFAMMEAKNNVIMI


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGPSPAIGKSFVSANFASIIASAGQKVLLIDADMRKGHLGKGVKLEHSHGLSDYLVNDKEIEGVINTGQIENLDIIVKGK
TGPSPAIGKSFVSANFASIIASAGQKVLLIDADMRKGHLGKGVKLEHSHGLSDYLVNDKEIEGVINTGQIENLDIIVKGK
       GKS                 LLIDADMR                                             
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPPNPSELLMHKRFTELCEWASENYDIVIIDTPPVLAVTDAAIVGRQAGTTLMITRFAKTAPKEIEVSIDRLEQAGVETK
TPPNPSELLMHKRFTELCEWASENYDIVIIDTPPVLAVTDAAIVGRQAGTTLMITRFAKTAPKEIEVSIDRLEQAGVETK
                           VIIDTPP                                              
       330       340       
....:....|....:....|....:..
GVILNAVEKTASSYYTYGYYNYSYKSE
GVILNAVEKTASSYYTYGYYNYSYKSE
             YYTYGYYNYSY   
© 1998-2019