BYKdb

Annotate results for A0A0B8QF75

A0A0B8QF75 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0B8QF75
DOMAINcd155/341TGPSPAIGKSFVSANFASIIASAGQKVLLIDADMRKGHLGRGVKLEHDNGLSDYLVNDKE
INEVIHSGQIENLEFIAKGKTPPNPSELLMHKRFTELCEWASENYDIVIIDTPPVLAVTD
AAIVGRQAGTTLMITRFAKTAPKEIEVSIDRLEQAGIETKGVILNAVEKTASSYYTYGYY
NYSYKSE
SITE-233/-235GKT
SITEWalker A'182/189LLIDADMR
SITEWalker B262/268VIIDTPP
SITEY Cluster328/338YYTYGYYNYSY
SITEWalker A162/164GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNQQIYLQLLNKSQELAIVKASTVGNVRILDGAESYSAPVKPKKPLIAVLATLLGGMLSVAFVLLRAAFHRGIENPDQIE


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELGIPVYATIPKSAQQEKIDRQLAKNRSRKKLVHAEEMLLASVNPADLSVEAFRSLRTSLHFAMMEAKNNIIMITGPSPA
                                                                          TGPSPA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IGKSFVSANFASIIASAGQKVLLIDADMRKGHLGRGVKLEHDNGLSDYLVNDKEINEVIHSGQIENLEFIAKGKTPPNPS
IGKSFVSANFASIIASAGQKVLLIDADMRKGHLGRGVKLEHDNGLSDYLVNDKEINEVIHSGQIENLEFIAKGKTPPNPS
 GKS                 LLIDADMR                                                   
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELLMHKRFTELCEWASENYDIVIIDTPPVLAVTDAAIVGRQAGTTLMITRFAKTAPKEIEVSIDRLEQAGIETKGVILNA
ELLMHKRFTELCEWASENYDIVIIDTPPVLAVTDAAIVGRQAGTTLMITRFAKTAPKEIEVSIDRLEQAGIETKGVILNA
                     VIIDTPP                                                    
       330       340 
....:....|....:....|.
VEKTASSYYTYGYYNYSYKSE
VEKTASSYYTYGYYNYSYKSE
       YYTYGYYNYSY   
© 1998-2019