BYKdb

Annotate results for A0A0C1PL30

A0A0C1PL30 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0C1PL30
DOMAINcd61/249TSSEPSEGKSTISNNMAVTWADQGTKVVLVDADLRRPTVHRSFDVSNRMGLTNYLSGNAD
LSAVVRETMVKDLSVITSGPVPPNPAELLGSKRIENLLSELTAEFDLVIVDAPPVNTVTD
AQLLASRIDGTVLVVPQGIADKNGVRRAKQLLETVHANILGTVMNRVTAQKSVGYYGGNY
YGGSYYGGY
SITEWalker A68/70GKS
SITEWalker A'88/95VLVDADLR
SITEWalker B168/174VIVDAPP
SITEY Cluster235/250YYGGNYYGGSYYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTTMAWFKRNKKKLDDTSLKYGVGLVSYTEPNGMIAEQFKTIRTNIQFSSVDKQLQSILFTSSEPSEGKSTISNNMAVTW
                                                            TSSEPSEGKSTISNNMAVTW
                                                                   GKS          
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADQGTKVVLVDADLRRPTVHRSFDVSNRMGLTNYLSGNADLSAVVRETMVKDLSVITSGPVPPNPAELLGSKRIENLLSE
ADQGTKVVLVDADLRRPTVHRSFDVSNRMGLTNYLSGNADLSAVVRETMVKDLSVITSGPVPPNPAELLGSKRIENLLSE
       VLVDADLR                                                                 
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTAEFDLVIVDAPPVNTVTDAQLLASRIDGTVLVVPQGIADKNGVRRAKQLLETVHANILGTVMNRVTAQKSVGYYGGNY
LTAEFDLVIVDAPPVNTVTDAQLLASRIDGTVLVVPQGIADKNGVRRAKQLLETVHANILGTVMNRVTAQKSVGYYGGNY
       VIVDAPP                                                            YYGGNY
       250      
....:....|....:.
YGGSYYGGYYGTDDKK
YGGSYYGGY       
YGGSYYGGYY      
© 1998-2019