BYKdb

Annotate results for A0A0C1QS61

A0A0C1QS61 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0C1QS61
DOMAINtad1/149MEKSVSSVLGVLKRRSLPAVAAFVATIGGAIAYLAVTPSQYEASARLMLDSKQTSVSELG
RNLSQVSSNTPGGPSPLADQAELVKSQRVLNRALQIFKSSYKSTTQVKIQDLNKGLGVKI
VPATNILQLSYQSKNPKLAAQLLNSVARA
DOMAINcd515/703SSSIAGEGKSIVASHLAAIAGMLSWRTLIIDADLRRPEQHTLFNLAGKPGVSDVLEGDIS
LADAVQSTDIENLDVLTCGELHGRPSQLLESIAMKSLVAEASENYDLVILDTPPLSACAD
AATLAKQSDGVMLVTRPGFTLKEILSRSVSELTRNRIPVLGVVVNGMTNQTEKYYQYSVN
GYLPRRQLT
SITEWalker A522/524GKS
SITEWalker A'542/549LIIDADLR
SITEWalker B622/628VILDTPP
SITEY Cluster688/696YYQYSVNGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKSVSSVLGVLKRRSLPAVAAFVATIGGAIAYLAVTPSQYEASARLMLDSKQTSVSELGRNLSQVSSNTPGGPSPLADQ
MEKSVSSVLGVLKRRSLPAVAAFVATIGGAIAYLAVTPSQYEASARLMLDSKQTSVSELGRNLSQVSSNTPGGPSPLADQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AELVKSQRVLNRALQIFKSSYKSTTQVKIQDLNKGLGVKIVPATNILQLSYQSKNPKLAAQLLNSVARAMEEESANTIRQ
AELVKSQRVLNRALQIFKSSYKSTTQVKIQDLNKGLGVKIVPATNILQLSYQSKNPKLAAQLLNSVARA           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAANVRKFLEMEVPKAREKLENAELTENRYRRSSGIISFTKQSESLVDSLAALENQERTLSAQLRELRSQDASLRQITNA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TALKSAYASVRGGQDEQLKELRTKLTELETKLAESRAKYTEDHPDVRSLLYQRNTIRNLYIQGLNRVSSGERPVSPNNVA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADQVSQNFSAQLIANDIERTAVENKLKSVQTQRANLQLRLAQLPIQQQNLTPLTRQREEAAETLKLLQGKYEEARIAEAQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVGNLRIIEEAQPPTSATSPKKPAVLVLATVLGTLLATSIVLLLEMMDNTLRDASEAEELLKLSLLGVLPRLPSKTLVLE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSQRFLDNMSLVEPYRMLFKTLEFRSDRMRVIVVSSSIAGEGKSIVASHLAAIAGMLSWRTLIIDADLRRPEQHTLFNLA
                                  SSSIAGEGKSIVASHLAAIAGMLSWRTLIIDADLRRPEQHTLFNLA
                                         GKS                 LIIDADLR           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKPGVSDVLEGDISLADAVQSTDIENLDVLTCGELHGRPSQLLESIAMKSLVAEASENYDLVILDTPPLSACADAATLAK
GKPGVSDVLEGDISLADAVQSTDIENLDVLTCGELHGRPSQLLESIAMKSLVAEASENYDLVILDTPPLSACADAATLAK
                                                             VILDTPP            
       650       660       670       680       690       700        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
QSDGVMLVTRPGFTLKEILSRSVSELTRNRIPVLGVVVNGMTNQTEKYYQYSVNGYLPRRQLTSSRSK
QSDGVMLVTRPGFTLKEILSRSVSELTRNRIPVLGVVVNGMTNQTEKYYQYSVNGYLPRRQLT     
                                               YYQYSVNGY            

© 1998-2019