BYKdb

Annotate results for A0A0C1TRU6

A0A0C1TRU6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0C1TRU6
DOMAINcd96/287TSTLGGEGKSITALNLAITLAQEYDNTVLLIDADLRKPMTAEYLGIPGERGLSEYLSVGA
HLPELLVRTGIGRLSILPAGKPAANPVELLSSQRMKDLLDEIRHRYPDRYVIIDAPPALP
FAEVRSLSSLVDSIVFVVREGQSSLANIDEAIGALNRKKIIGIVFNEASAVGLSSKYGYG
YRYGGYGQSSEP
SITEWalker A103/105GKS
SITEWalker A'124/131LLIDADLR
SITEWalker B206/212VIIDAPP
SITE-201/-205YPDRY
SITEY Cluster272/281YGYGYRYGGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRIEQALEKAAMLRGTTTESGPVAVPRQTDDVPPRERAGLPPFPAEPLDGIRHDNPLLATLNDPHSYVSEEYRKLKSAI


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAGTSVGEFRNTVMITSTLGGEGKSITALNLAITLAQEYDNTVLLIDADLRKPMTAEYLGIPGERGLSEYLSVGAHLPEL
               TSTLGGEGKSITALNLAITLAQEYDNTVLLIDADLRKPMTAEYLGIPGERGLSEYLSVGAHLPEL
                      GKS                  LLIDADLR                             
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVRTGIGRLSILPAGKPAANPVELLSSQRMKDLLDEIRHRYPDRYVIIDAPPALPFAEVRSLSSLVDSIVFVVREGQSSL
LVRTGIGRLSILPAGKPAANPVELLSSQRMKDLLDEIRHRYPDRYVIIDAPPALPFAEVRSLSSLVDSIVFVVREGQSSL
                                             VIIDAPP                            
       250       260       270       280       290       300       310
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANIDEAIGALNRKKIIGIVFNEASAVGLSSKYGYGYRYGGYGQSSEPAEARSKAEKTGKLARIMGKGGSK
ANIDEAIGALNRKKIIGIVFNEASAVGLSSKYGYGYRYGGYGQSSEP                       
                               YGYGYRYGGY                             
© 1998-2019