BYKdb

Annotate results for A0A0C1XJI7

A0A0C1XJI7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0C1XJI7
DOMAINtad1/152MEKGISSLLAVLKRRAFPALVTFTAVIGGAFAYLTVTPRLYEASARLMQDDRRVSVSELG
RDLTSVSSGAPGGPSPLANQAELVKSERVLERAIALASLKSYNGSPGSQITSGELNQGLD
VKIVPATNILELSYKSKDPELAAQLLNAVSQA
DOMAINcd520/708SSTLSGEGKSIVASHLAAISAMLSRRTLIIDADLRRPMQHTLFNLAPKPGITDVIEKRRS
LNQAVQLTDVDNLHVLTGGEFHGRPSQLLESPAMKSLVAEAAENYDMVIIDTAPISACAD
AATLARQSDGIMLVTRPSITIKEVLQRAVSELNNNQIPVLGVVVNGMTEQTEKYFRYPVD
NDRPLGGRL
SITEWalker A527/529GKS
SITEWalker A'547/554LIIDADLR
SITEWalker B627/633VIIDTAP
SITEY Cluster693/696YFRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKGISSLLAVLKRRAFPALVTFTAVIGGAFAYLTVTPRLYEASARLMQDDRRVSVSELGRDLTSVSSGAPGGPSPLANQ
MEKGISSLLAVLKRRAFPALVTFTAVIGGAFAYLTVTPRLYEASARLMQDDRRVSVSELGRDLTSVSSGAPGGPSPLANQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AELVKSERVLERAIALASLKSYNGSPGSQITSGELNQGLDVKIVPATNILELSYKSKDPELAAQLLNAVSQAMIEENTKT
AELVKSERVLERAIALASLKSYNGSPGSQITSGELNQGLDVKIVPATNILELSYKSKDPELAAQLLNAVSQA        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISSEATKVREFLETSEIPNAYKRLREAENKESQYRHISGIISFEEQTKSTVESLATLEDQERSLTAQLQEAKGRDASLRQ


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ITDAKSLDKAYASVRGGQDEQLKTLRAKLTELNTKLIEARLRLTENHPSVISLVEQRDNLNKLYTEQLGRVSSANSSVAT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSVAGDQISQDLTSKLLANETERSAIENKLKTVQAQRTQLQSRLAKLPLQQQPLIALTREREDATASLKSLQSKLEEARI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEAQKVSNLRLIEAAKPPTIASSPKRSAVLALATVFGTVLGTGVMLLLEVLDNTLKDASEAEELLSLPLLGVLPRLPAKT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVLEPADRFLDDIGLVEPYRMLLKTLEFRSTDKVQVIVVSSTLSGEGKSIVASHLAAISAMLSRRTLIIDADLRRPMQHT
                                       SSTLSGEGKSIVASHLAAISAMLSRRTLIIDADLRRPMQHT
                                              GKS                 LIIDADLR      
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LFNLAPKPGITDVIEKRRSLNQAVQLTDVDNLHVLTGGEFHGRPSQLLESPAMKSLVAEAAENYDMVIIDTAPISACADA
LFNLAPKPGITDVIEKRRSLNQAVQLTDVDNLHVLTGGEFHGRPSQLLESPAMKSLVAEAAENYDMVIIDTAPISACADA
                                                                  VIIDTAP       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATLARQSDGIMLVTRPSITIKEVLQRAVSELNNNQIPVLGVVVNGMTEQTEKYFRYPVDNDRPLGGRLPRRLTAVDSGRK
ATLARQSDGIMLVTRPSITIKEVLQRAVSELNNNQIPVLGVVVNGMTEQTEKYFRYPVDNDRPLGGRL            
                                                    YFRY                        
     
....:
NYDNG


© 1998-2019