BYKdb

Annotate results for A0A0C1XVC4

A0A0C1XVC4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0C1XVC4
DOMAINtad8/154EEIDVQKYLLVLKRRWLIASGVFAVFATLGGINFVMQPPVYEGSGKLLFQSNQTSSLTGV
GEKIGHLESIKREANPLDTQAIVMQSEPVILDVIKTLNLKDKKGNPLSPDAISIKTEAVV
GTDVLKVSYTSDNPESAKAIVDQVMKS
DOMAINcd533/719TSSVSGEGKTEVAANLAAVMSLAGRRVLLVDADMRQPSQHHLWGLINSVGLSNFMVGENK
FTNSVRKIANNLSVLTAGVMPPNPLALIDSERMTSFIDILSKTYDCVIFDTPPLIGSADA
AVLGNMVDGVLIVVRPGVVDSNTATAAKSLLARSEANILGIVANAVNVKHEPDNYFYYNN
SRTENGV
SITEWalker A540/542GKT
SITEWalker A'560/567LLVDADMR
SITEWalker B639/645VIFDTPP
SITEY Cluster707/710YFYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
METKNYPEEIDVQKYLLVLKRRWLIASGVFAVFATLGGINFVMQPPVYEGSGKLLFQSNQTSSLTGVGEKIGHLESIKRE
       EEIDVQKYLLVLKRRWLIASGVFAVFATLGGINFVMQPPVYEGSGKLLFQSNQTSSLTGVGEKIGHLESIKRE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANPLDTQAIVMQSEPVILDVIKTLNLKDKKGNPLSPDAISIKTEAVVGTDVLKVSYTSDNPESAKAIVDQVMKSYIANNI
ANPLDTQAIVMQSEPVILDVIKTLNLKDKKGNPLSPDAISIKTEAVVGTDVLKVSYTSDNPESAKAIVDQVMKS      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSNRTQAISAGGFIEKELPRAKAQLEKAAEALREFKLKNQILELAEETRASVKNISDVENELAKARSELADASAQEIQIR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQMNLPVDQAVDITSLSQIPAVQGLLAELQKVETQLAALKARYTETHPAVVDLESQEANINSLLQQQISQSLGYKAAIAP


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKLQMGEIKQNLTSDFVRLQSQRLGLEKKVEALSAIIASYKRRADVMPNLEKQQGDLERGLSIAQKSYENLLTRQQEIQV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AENQTVGNAKVVEYAKVAPSPAVKRKRFVITLGSGFVGLLLGVASAFFVDLIDRRLKTTKEAEALFGYTLLGLIPKFENN


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NTSTPLDSSLEKVSQRIIVATSPRTVIHEAYQMLQANLKFISLDRKISTIVVTSSVSGEGKTEVAANLAAVMSLAGRRVL
                                                    TSSVSGEGKTEVAANLAAVMSLAGRRVL
                                                           GKT                 L
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDADMRQPSQHHLWGLINSVGLSNFMVGENKFTNSVRKIANNLSVLTAGVMPPNPLALIDSERMTSFIDILSKTYDCVI
LVDADMRQPSQHHLWGLINSVGLSNFMVGENKFTNSVRKIANNLSVLTAGVMPPNPLALIDSERMTSFIDILSKTYDCVI
LVDADMR                                                                       VI
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDTPPLIGSADAAVLGNMVDGVLIVVRPGVVDSNTATAAKSLLARSEANILGIVANAVNVKHEPDNYFYYNNSRTENGVE
FDTPPLIGSADAAVLGNMVDGVLIVVRPGVVDSNTATAAKSLLARSEANILGIVANAVNVKHEPDNYFYYNNSRTENGV 
FDTPP                                                             YFYY          
        
....:...
KVDTASIP


© 1998-2019