BYKdb

Annotate results for A0A0C1ZPY7

A0A0C1ZPY7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0C1ZPY7
DOMAINtad51/216TMGSALEILAILRRRWLRIAVTCLIVVVTTVLAVSLLRPQYRAEVTLLLQPSGAQVLDEV
QGLGEQLDTNTYRHYYRTQHEIISSRAVAAEALARLGLAEDPGFLGIADLADPNERAKAE
AEIDPIERLRELVEIREVHDSRVVRIRVEYFDPALAAEIANTVAQA
DOMAINcd577/769TSPGSSEGKSSTALNLALSWCQAGKRVLLIDADMRRPRLHEVFPAGLDAGNVGLASVLQG
SCELDDAIERGLAGAPEQLAVLRCGPVPETPSELLDTHAFRRLLAKLRERFDLVIFDSPP
VLPVVDALLIARQVDGVVLVARAGATSEHEVQQSLGLLRQRDTNLLGLVLNDVDLRREGG
RYGSAYYRYEATT
SITEWalker A584/586GKS
SITEWalker A'604/611LLIDADMR
SITEWalker B690/696VIFDSPP
SITEY Cluster758/765YGSAYYRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLDDPRDIPSDAQLVGPARGDPRRPEGRTWPRSTHTPPYAEAEPAASWTATMGSALEILAILRRRWLRIAVTCLIVVVTT
                                                  TMGSALEILAILRRRWLRIAVTCLIVVVTT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLAVSLLRPQYRAEVTLLLQPSGAQVLDEVQGLGEQLDTNTYRHYYRTQHEIISSRAVAAEALARLGLAEDPGFLGIADL
VLAVSLLRPQYRAEVTLLLQPSGAQVLDEVQGLGEQLDTNTYRHYYRTQHEIISSRAVAAEALARLGLAEDPGFLGIADL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADPNERAKAEAEIDPIERLRELVEIREVHDSRVVRIRVEYFDPALAAEIANTVAQAYLDHVGGERSDTGARAAGDLGLER
ADPNERAKAEAEIDPIERLRELVEIREVHDSRVVRIRVEYFDPALAAEIANTVAQA                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DRARQRLRAAEQALDAFKAQHQITTIALEDRQSVITQNIIELSLRTKAAQASSFEAKNLYEQAKKLHQRGIAAGAAALLR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSERNIFDHLLTERLAAEAEFNAIDLQYGPRHPEWKQAKQRLELFERTTKDQAGGHLATFLARYEAAHATEQQLAAELER


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERLRALELTRLEPGFRELARDVADAEEIYLVLSRRDTEVELTNRIEDEPQVRILDPATTPREAVRPRVALCVAASVVVGL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLGCVLAVSVDLRDHTLRDLRDAERAVAGWDIAVLGQLPKLAPDPAIGPANLRAQRMRRDLQTHLLPQSLMAERARKVRA


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIGFGMGKERCPVLLVTSPGSSEGKSSTALNLALSWCQAGKRVLLIDADMRRPRLHEVFPAGLDAGNVGLASVLQGSCEL
                TSPGSSEGKSSTALNLALSWCQAGKRVLLIDADMRRPRLHEVFPAGLDAGNVGLASVLQGSCEL
                       GKS                 LLIDADMR                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DDAIERGLAGAPEQLAVLRCGPVPETPSELLDTHAFRRLLAKLRERFDLVIFDSPPVLPVVDALLIARQVDGVVLVARAG
DDAIERGLAGAPEQLAVLRCGPVPETPSELLDTHAFRRLLAKLRERFDLVIFDSPPVLPVVDALLIARQVDGVVLVARAG
                                                 VIFDSPP                        
       730       740       750       760         
....:....|....:....|....:....|....:....|....:....
ATSEHEVQQSLGLLRQRDTNLLGLVLNDVDLRREGGRYGSAYYRYEATT
ATSEHEVQQSLGLLRQRDTNLLGLVLNDVDLRREGGRYGSAYYRYEATT
                                     YGSAYYRY    

© 1998-2019