BYKdb

Annotate results for A0A0C2CU23

A0A0C2CU23 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0C2CU23
DOMAINtad16/284RGDGLADLWRSVVRHKTLLGAVTGTCCAAGVLYVLLATPQYRAEALLRVQSKAGTSISAL
SDVSGSMAADASASDESDVLTSRSVVSAAIAATGAETVVETQSHFPLIGNYLASRHATDN
ELAPALFGLDQYAWGGERLKPGVFTVPEAALKAKFHVVAGQGGRWTLYDKDDNALAQGRV
GETVPFQVDTPEGRAPGELRIDMLRARPGVSFELRKYSQQTTFDNVLARLRTAIPPRDST
LRDPALIRLSYQAESPLVAQGMVNAIIKT
DOMAINcd603/789TGPTQGVGKSFVSSNFAYLLAETRASVLLIDADMRQGRLRHLVDGRTGPGLAEVLEGTAR
VDEAIVPLGNGGLSIMDAGAAYPENPAELLGRPAFQETLTMLRDIYDYIVIDSPPVLPVS
DALSIAMQNCDLVLLVSRADRTGARQLEETLRRLENVGAKVGGHVFNGFAPGRYGAREEY
GFRAVAR
SITEWalker A610/612GKS
SITEWalker A'630/637LLIDADMR
SITEWalker B711/717IVIDSPP
SITE-708/-710YDY
SITEY Cluster776/782YGAREEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLSYNMRPVMTPVPQRGDGLADLWRSVVRHKTLLGAVTGTCCAAGVLYVLLATPQYRAEALLRVQSKAGTSISALSDVSG
               RGDGLADLWRSVVRHKTLLGAVTGTCCAAGVLYVLLATPQYRAEALLRVQSKAGTSISALSDVSG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SMAADASASDESDVLTSRSVVSAAIAATGAETVVETQSHFPLIGNYLASRHATDNELAPALFGLDQYAWGGERLKPGVFT
SMAADASASDESDVLTSRSVVSAAIAATGAETVVETQSHFPLIGNYLASRHATDNELAPALFGLDQYAWGGERLKPGVFT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VPEAALKAKFHVVAGQGGRWTLYDKDDNALAQGRVGETVPFQVDTPEGRAPGELRIDMLRARPGVSFELRKYSQQTTFDN
VPEAALKAKFHVVAGQGGRWTLYDKDDNALAQGRVGETVPFQVDTPEGRAPGELRIDMLRARPGVSFELRKYSQQTTFDN

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLARLRTAIPPRDSTLRDPALIRLSYQAESPLVAQGMVNAIIKTYQERDVERRAAQAQTSLGFLKKRLPALKSDLEAAEN
VLARLRTAIPPRDSTLRDPALIRLSYQAESPLVAQGMVNAIIKT                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLNTFRTQTGTVDIAQQNTALITRMSRLEEQQTNLQLALDAAQHRFQPGNENYQSALTQLNQVKHEIAETSKIASNLPTV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRQYVELARDVAVTTQLYTSVLTNAQQLEVAAASTPPGIAVVDWAVAPEKQSWPRGWIVLLGSIFGGLFVSTVSIYLIAL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NRKELRSPEEIDHFSQLPRLAVIARSTAQLKQDVRALTHNAAPAKLLAMTSPTDPSIEALRSLRSSVRAMLSGAPVPMNH


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGLGGMNPFNQINGMPFNGTTTVMNPSYVADANQPGGKVILFTGPTQGVGKSFVSSNFAYLLAETRASVLLIDADMRQGR
                                          TGPTQGVGKSFVSSNFAYLLAETRASVLLIDADMRQGR
                                                 GKS                 LLIDADMR   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRHLVDGRTGPGLAEVLEGTARVDEAIVPLGNGGLSIMDAGAAYPENPAELLGRPAFQETLTMLRDIYDYIVIDSPPVLP
LRHLVDGRTGPGLAEVLEGTARVDEAIVPLGNGGLSIMDAGAAYPENPAELLGRPAFQETLTMLRDIYDYIVIDSPPVLP
                                                                      IVIDSPP   
       730       740       750       760       770       780         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
VSDALSIAMQNCDLVLLVSRADRTGARQLEETLRRLENVGAKVGGHVFNGFAPGRYGAREEYGFRAVAR
VSDALSIAMQNCDLVLLVSRADRTGARQLEETLRRLENVGAKVGGHVFNGFAPGRYGAREEYGFRAVAR
                                                       YGAREEY       

© 1998-2019