BYKdb

Annotate results for A0A0C2I782

A0A0C2I782 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0C2I782
DOMAINcd93/268TSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPMVGACLGLPMEKSLNELLDHEA
ELQEVLVNPTLPRFVVLPTREPIPLSTEVLSSPTVSYLIADLRERYDSRIVIFDLPPLLS
SDDVITVLPKFDCVLLVVANGMNSKKEIEESLYHLGTANLIGTVLNKADPPNRSYY
SITEWalker A100/102GKT
SITEWalker A'121/128LLVDFDLR
SITEWalker B203/209VIFDLPP
SITEY Cluster267/268YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEIIKPDTEDSEQQPSTSLVTVPKAMTETGQSAGLNALSYVQTKVVPLRPDHLERNRIVAYNKNSNMGGAFDLLRTQVLK


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VMEENGWRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPMVGACLGLPMEKSLNELLDHEAELQEVLVN
            TSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPMVGACLGLPMEKSLNELLDHEAELQEVLVN
                   GKT                  LLVDFDLR                                
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTLPRFVVLPTREPIPLSTEVLSSPTVSYLIADLRERYDSRIVIFDLPPLLSSDDVITVLPKFDCVLLVVANGMNSKKEI
PTLPRFVVLPTREPIPLSTEVLSSPTVSYLIADLRERYDSRIVIFDLPPLLSSDDVITVLPKFDCVLLVVANGMNSKKEI
                                          VIFDLPP                               
       250       260        
....:....|....:....|....:...
EESLYHLGTANLIGTVLNKADPPNRSYY
EESLYHLGTANLIGTVLNKADPPNRSYY
                          YY
© 1998-2019