BYKdb

Annotate results for A0A0C2LVR7

A0A0C2LVR7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0C2LVR7
DOMAINtad8/156EEIDFQKYLLVLQRRWVPAVGVFGAVVTLVSLYAFSLKPTYNAEGSLLIKTNRTSSLTGL
GEALGRLESLGVNNNPSDTQAKIVASVPVIQETITELDLRDKRGKPLTIQELSKKLKIKG
DKGTEVLEVSYTDTNPTLAAKVVNKLMQA
DOMAINcd534/722TSSVAKEGKSEVAVNLAVAMAQVGRRVLLVDADMRHPVQHHVWGMTNAVGLSNVIVDELP
IDIAVQEAIPNLYVLPSGVVPPNPMALLDSRRMAALVNTFVKDYDFVIFDTPPLAGTADA
AVLGKLADGILLVVRPGVVDSASANAAKEFLTQSGQQVLGMVINGVNVKREPDSYFYYTK
ESDEPGVVS
SITEWalker A541/543GKS
SITEWalker A'561/568LLVDADMR
SITE-587/-593VIVDELP
SITEY Cluster708/711YFYY
SITEWalker B640/646VIFDTPP
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MESKPNFEEIDFQKYLLVLQRRWVPAVGVFGAVVTLVSLYAFSLKPTYNAEGSLLIKTNRTSSLTGLGEALGRLESLGVN
       EEIDFQKYLLVLQRRWVPAVGVFGAVVTLVSLYAFSLKPTYNAEGSLLIKTNRTSSLTGLGEALGRLESLGVN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NNPSDTQAKIVASVPVIQETITELDLRDKRGKPLTIQELSKKLKIKGDKGTEVLEVSYTDTNPTLAAKVVNKLMQAYIKN
NNPSDTQAKIVASVPVIQETITELDLRDKRGKPLTIQELSKKLKIKGDKGTEVLEVSYTDTNPTLAAKVVNKLMQA    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NIRANREEAVSARKFIQKQLPATEISVKRAEAQLRRFKEENKVIALQEEATAAVNEISKLEEQISQAEAQLADVTAKSQK


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQNQAKIDSQQGVTFTSLSQTPGIQQVLTQLQEAQSQLAVERTRLQPEHPIIINLEEKVAALNSLLQQRLKQAVGNSRQI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTLNLQTGELRQKLLEDYARSEAERVGLERQIITLSSKRSAYKQRANVLPKLEQNQRQLERKLKAAQTTYETLLTRLQEI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVAENQNVGNARIISPALIPDKPAGSQKILVITGGGVLGILLGVIAAFSLDLIDRSVKTVKEARELFKYTMLGVIPSINS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSKKSSFLPGVDQPIPRVIGTDIPQFPVGDAYQMLQANLMFLSSDNQLKAIVVTSSVAKEGKSEVAVNLAVAMAQVGRRV
                                                     TSSVAKEGKSEVAVNLAVAMAQVGRRV
                                                            GKS                 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLVDADMRHPVQHHVWGMTNAVGLSNVIVDELPIDIAVQEAIPNLYVLPSGVVPPNPMALLDSRRMAALVNTFVKDYDFV
LLVDADMRHPVQHHVWGMTNAVGLSNVIVDELPIDIAVQEAIPNLYVLPSGVVPPNPMALLDSRRMAALVNTFVKDYDFV
LLVDADMR                                                                       V
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IFDTPPLAGTADAAVLGKLADGILLVVRPGVVDSASANAAKEFLTQSGQQVLGMVINGVNVKREPDSYFYYTKESDEPGV
IFDTPPLAGTADAAVLGKLADGILLVVRPGVVDSASANAAKEFLTQSGQQVLGMVINGVNVKREPDSYFYYTKESDEPGV
IFDTPP                                                             YFYY         
       730       740 
....:....|....:....|.
VSRNSVIVRQNRREAIGRGDV
VS                   

© 1998-2019