BYKdb

Annotate results for A0A0C2MDK7

A0A0C2MDK7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0C2MDK7
DOMAINtad1/151MEKGISSVLAVLRRRSLPAVAAFVAVMGGAIAYLAVTPSKYEAYARLMLDDKRVSVSELG
RDLTQVSANAPGISPLADQAELIKSQRVLERAIAIAFPQTKGNLSLSPVSTAELSHNLKV
KIVPATNILELSYQSRDPQLAAKVLNAVSQA
DOMAINcd519/705SSTISGEGKSVVASHLAAVVGMLSWRTLIIDADLRRPSQHTLFNLAPGPGITDVLEGNIS
LLDAVQPTDIENLDVLTCGELHGRPSQLLESIAMKSLMAEAAENYDLVIIDTPPLTACAD
ALTLAQEGNGLMLVTRPGFTDKEVLSRCVRELTQNRISILGVVVNGMTHLTQNYRYPTYR
YRPRLPK
SITEWalker A526/528GKS
SITEWalker A'546/553LIIDADLR
SITEWalker B626/632VIIDTPP
SITEY Cluster692/699YRYPTYRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKGISSVLAVLRRRSLPAVAAFVAVMGGAIAYLAVTPSKYEAYARLMLDDKRVSVSELGRDLTQVSANAPGISPLADQA
MEKGISSVLAVLRRRSLPAVAAFVAVMGGAIAYLAVTPSKYEAYARLMLDDKRVSVSELGRDLTQVSANAPGISPLADQA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELIKSQRVLERAIAIAFPQTKGNLSLSPVSTAELSHNLKVKIVPATNILELSYQSRDPQLAAKVLNAVSQAMVEDNVKSI
ELIKSQRVLERAIAIAFPQTKGNLSLSPVSTAELSHNLKVKIVPATNILELSYQSRDPQLAAKVLNAVSQA         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLEATKVKQFLEQKQVPEAEKKLLQAEDLENKYRKSSGIVSVEEQTKSLVQSIATLEHQERTLSAQLQEIKTKDASLGQI


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TNAGNLNNAYSSVRSGQDDEIKKLRAKLSELENKIIEARLRFTENHPVVANLVGERDALRKVLSEQLARVSTKDQSVSTK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NFAGDQLSQELNSKFILNRIEESAVKERLTLLQKKEADLQNRLAQLPIKQQQLTILTRKREEAAASLKFLQGKLEEARLT


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAQKVSNIRAIENAVAPSSPSQPKQKVVLALAAAFGTMLAVGVVLLLEVMDNTLRDATEAEELLQLPLLGILPRLPAKTL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLEPANQFLDNMELIEPYRTLFKTLEFRRSEQLRAIVVSSTISGEGKSVVASHLAAVVGMLSWRTLIIDADLRRPSQHTL
                                      SSTISGEGKSVVASHLAAVVGMLSWRTLIIDADLRRPSQHTL
                                             GKS                 LIIDADLR       
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FNLAPGPGITDVLEGNISLLDAVQPTDIENLDVLTCGELHGRPSQLLESIAMKSLMAEAAENYDLVIIDTPPLTACADAL
FNLAPGPGITDVLEGNISLLDAVQPTDIENLDVLTCGELHGRPSQLLESIAMKSLMAEAAENYDLVIIDTPPLTACADAL
                                                                 VIIDTPP        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLAQEGNGLMLVTRPGFTDKEVLSRCVRELTQNRISILGVVVNGMTHLTQNYRYPTYRYRPRLPKSQKQLIGAGDSSRNS
TLAQEGNGLMLVTRPGFTDKEVLSRCVRELTQNRISILGVVVNGMTHLTQNYRYPTYRYRPRLPK               
                                                   YRYPTYRY                     
       
....:..
ANGMRQR


© 1998-2019