BYKdb

Annotate results for A0A0C2PT44

A0A0C2PT44 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0C2PT44
DOMAINtad8/154EEIDIQKYWLVLKRRWPIVAGSVLTSIGLTTFAVFLQKPEYQATGMLLFKSDRTSSLTKV
GEKIGDLESLMREGNPLETQAVILKSEPILEEVIKTLELKDKKGETLDSESLKIKVEPIV
GTDVLKVSYTSENPELAASVVNQLMKS
DOMAINcd541/729TSSVAGEGKSEVSANLAAVLAQAGRRVLLVDADMRKPTQHHFWGVINSVGLSNLIVCQAE
FPQGVQTVTKDLSVLTAGVVPPNPLALIDSDRMASLIKMFSDKYDYIVFDTPPLVGTADA
AVLGKMADGVLLVVRPGVVDSASATAAKSLLERSDANILGMVANAVNVKHEPDSYFYYSS
PRVGQSVVE
SITEWalker A548/550GKS
SITEWalker A'568/575LLVDADMR
SITEWalker B647/653IVFDTPP
SITE-644/-646YDY
SITEY Cluster715/718YFYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
METKGYQEEIDIQKYWLVLKRRWPIVAGSVLTSIGLTTFAVFLQKPEYQATGMLLFKSDRTSSLTKVGEKIGDLESLMRE
       EEIDIQKYWLVLKRRWPIVAGSVLTSIGLTTFAVFLQKPEYQATGMLLFKSDRTSSLTKVGEKIGDLESLMRE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GNPLETQAVILKSEPILEEVIKTLELKDKKGETLDSESLKIKVEPIVGTDVLKVSYTSENPELAASVVNQLMKSYVANNI
GNPLETQAVILKSEPILEEVIKTLELKDKKGETLDSESLKIKVEPIVGTDVLKVSYTSENPELAASVVNQLMKS      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSNRAQVFAAGEYIKKQLRYARAELERSAEALRQFKTRYKIIELPEEASAAVQNLGQIDQEINQARAALADVSAQEAKIN


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TQLNLAGDQAVEVASISQIPGVQEVLGELQKVQTKLANEKARYTSEHPDIAELKNQEVTLNALLQQRIEQVLGAKGIKQV


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGTQQNVPPGKLQVAKIKENLTSEFAKIQAQRQGLESKIQALSKIQASYKERLAMMPNLEKKQGDYERKLSISKKNYENL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTRLQEIEVAEKQTVGNAREIQPAKVPKKPVLSKVVLLLAGGGVFVGLLLGVAAAFFVDLVDRSLKTVKEAETFFGYTML


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLIPKFESNSTSAATKLMSEGVSARVIVATSPRSVIHEAYQMLQANLKFISHKKVRTIVVTSSVAGEGKSEVSANLAAVL
                                                            TSSVAGEGKSEVSANLAAVL
                                                                   GKS          
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQAGRRVLLVDADMRKPTQHHFWGVINSVGLSNLIVCQAEFPQGVQTVTKDLSVLTAGVVPPNPLALIDSDRMASLIKMF
AQAGRRVLLVDADMRKPTQHHFWGVINSVGLSNLIVCQAEFPQGVQTVTKDLSVLTAGVVPPNPLALIDSDRMASLIKMF
       LLVDADMR                                                                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDKYDYIVFDTPPLVGTADAAVLGKMADGVLLVVRPGVVDSASATAAKSLLERSDANILGMVANAVNVKHEPDSYFYYSS
SDKYDYIVFDTPPLVGTADAAVLGKMADGVLLVVRPGVVDSASATAAKSLLERSDANILGMVANAVNVKHEPDSYFYYSS
      IVFDTPP                                                             YFYY  
       730       740  
....:....|....:....|..
PRVGQSVVETEVGTEQWTHKSI
PRVGQSVVE             

© 1998-2019