BYKdb

Annotate results for A0A0C2UF46

A0A0C2UF46 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0C2UF46
DOMAINcd49/230TSASPGEGKSTTAINLAATYAQAEHKVLLIDADLRKPSIHHTFLCSNRFGLTNWLTNSRP
VSEVVVKTFVPNLYLLPSGAIAPNPSELLSSKKMSKLLEELKQEFDIIILDSPPVLAVTD
AQIIASISDGVVMVADSGKVKIATAQKAKEKLEHVNAKILGVAINNIKRSSHDDYYYYYG
ET
SITEWalker A56/58GKS
SITEWalker A'76/83LLIDADLR
SITEWalker B156/162IILDSPP
SITEY Cluster223/227YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKPILRTKKRHIIVHNNPKSPVSEAYRSLRTNIQFSSVDTRIQTIMVTSASPGEGKSTTAINLAATYAQAEHKVLLIDA
                                                TSASPGEGKSTTAINLAATYAQAEHKVLLIDA
                                                       GKS                 LLIDA
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRKPSIHHTFLCSNRFGLTNWLTNSRPVSEVVVKTFVPNLYLLPSGAIAPNPSELLSSKKMSKLLEELKQEFDIIILDS
DLRKPSIHHTFLCSNRFGLTNWLTNSRPVSEVVVKTFVPNLYLLPSGAIAPNPSELLSSKKMSKLLEELKQEFDIIILDS
DLR                                                                        IILDS
       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPVLAVTDAQIIASISDGVVMVADSGKVKIATAQKAKEKLEHVNAKILGVAINNIKRSSHDDYYYYYGET
PPVLAVTDAQIIASISDGVVMVADSGKVKIATAQKAKEKLEHVNAKILGVAINNIKRSSHDDYYYYYGET
PP                                                            YYYYY   
© 1998-2019