BYKdb

Annotate results for A0A0C2UT93

A0A0C2UT93 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0C2UT93
DOMAINcd48/236ASSQFGEGKSTTASNLAVTYAQTNRKVLLIDCDMRRPSQHHIFMLSNRYGLSSYLSHQVD
LDEIIVDSTIPNLSVIVAGPIPPNPSELLASKRMSAMLEQLREQFDMIIIDTPPIMAVAD
AQIAATLCDGVLLVMDSGRVKREIAMKSKQKLEHVKARILGVVLNKISRKNANSYYYYYY
GDRDQGEEA
SITEWalker A55/57GKS
SITEWalker A'75/82LLIDCDMR
SITEWalker B155/161IIIDTPP
SITE-96/-101YGLSSY
SITEY Cluster222/227YYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSSSRRNERWPLITNTNTKSPISEAYRILRTNIEFSNVDRNLKCIMFASSQFGEGKSTTASNLAVTYAQTNRKVLLIDCD
                                               ASSQFGEGKSTTASNLAVTYAQTNRKVLLIDCD
                                                      GKS                 LLIDCD
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRRPSQHHIFMLSNRYGLSSYLSHQVDLDEIIVDSTIPNLSVIVAGPIPPNPSELLASKRMSAMLEQLREQFDMIIIDTP
MRRPSQHHIFMLSNRYGLSSYLSHQVDLDEIIVDSTIPNLSVIVAGPIPPNPSELLASKRMSAMLEQLREQFDMIIIDTP
MR                                                                        IIIDTP
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
PIMAVADAQIAATLCDGVLLVMDSGRVKREIAMKSKQKLEHVKARILGVVLNKISRKNANSYYYYYYGDRDQGEEA
PIMAVADAQIAATLCDGVLLVMDSGRVKREIAMKSKQKLEHVKARILGVVLNKISRKNANSYYYYYYGDRDQGEEA
P                                                            YYYYYY         
© 1998-2019