BYKdb

Annotate results for A0A0C2VGB9

A0A0C2VGB9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0C2VGB9
DOMAINcd53/233SSSSPGEGKSTTAANLAIVFAQQGKKVLLVDADMRKPTVHFTFNMMNTIGLTTVLTRQSE
LDKTANQTDIENLDILSSGPIPPNPSELLSSRVMNRFFDTAKNMYDLIIFDTPPVLAVTD
AQVLSHQCDGTILVVRAGIADKDKVTKAKEAIVSAKAKILGVVLNDKKMKSNDEYYYYGN
N
SITEWalker A60/62GKS
SITEWalker A'80/87LLVDADMR
SITEWalker B160/166IIFDTPP
SITEY Cluster227/230YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAAKPKKSNMDSKKRNLIAEYNPKSVASEQYRTIRTNIQFSAIDEDIRTITVSSSSPGEGKSTTAANLAIVFAQQGKKVL
                                                    SSSSPGEGKSTTAANLAIVFAQQGKKVL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDADMRKPTVHFTFNMMNTIGLTTVLTRQSELDKTANQTDIENLDILSSGPIPPNPSELLSSRVMNRFFDTAKNMYDLI
LVDADMRKPTVHFTFNMMNTIGLTTVLTRQSELDKTANQTDIENLDILSSGPIPPNPSELLSSRVMNRFFDTAKNMYDLI
LVDADMR                                                                        I
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
IFDTPPVLAVTDAQVLSHQCDGTILVVRAGIADKDKVTKAKEAIVSAKAKILGVVLNDKKMKSNDEYYYYGNN
IFDTPPVLAVTDAQVLSHQCDGTILVVRAGIADKDKVTKAKEAIVSAKAKILGVVLNDKKMKSNDEYYYYGNN
IFDTPP                                                            YYYY   
© 1998-2019