BYKdb

Annotate results for A0A0C2Z856

A0A0C2Z856 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0C2Z856
DOMAINtad13/259DEVDLVSIFKVINQYKISIILIALIAFMTTYIYLYFKPSIYSAYALVEVKGQEDTVNTLT
QDFIAKQIGSGTVEKVDKEMEILKTFYLNNKALKFVDLRVKYFIDSEYKNVEIYNKIPIT
IKDIKVKDGSSGYLKLQLTQAKNGFYLTKNQSFISSLVSFNEVSSALMAYDKPLQIEGYE
FVVHKNEYSSSPVYFQIYSSNQAIFESTVLPNLHISQANVATPLIKIEYTDNVPQRAFKY
ADALAES
DOMAINcd590/776TSSISGEGKTTVSANLASIFQITNFKTVVIDLDMRKPSLHKLFGVANAKGMSTYLSYRSE
LHEIINKTKYPFLDLITAGPIPPNPSELVFVKRLELLIKELKNRYEFIIIDTSPIGMVND
SFTLMKYSDINLMVFRENFTKKDFVSSLDRAIKEQHVGKIGIILNGSKVKGSSGYGYGYG
YGAEGNG
SITEWalker A597/599GKT
SITEWalker A'617/624VVIDLDMR
SITEWalker B697/703IIIDTSP
SITE-643/-646YLSY
SITEY Cluster764/770YGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLEIEKKVKRPDEVDLVSIFKVINQYKISIILIALIAFMTTYIYLYFKPSIYSAYALVEVKGQEDTVNTLTQDFIAKQI
            DEVDLVSIFKVINQYKISIILIALIAFMTTYIYLYFKPSIYSAYALVEVKGQEDTVNTLTQDFIAKQI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSGTVEKVDKEMEILKTFYLNNKALKFVDLRVKYFIDSEYKNVEIYNKIPITIKDIKVKDGSSGYLKLQLTQAKNGFYLT
GSGTVEKVDKEMEILKTFYLNNKALKFVDLRVKYFIDSEYKNVEIYNKIPITIKDIKVKDGSSGYLKLQLTQAKNGFYLT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KNQSFISSLVSFNEVSSALMAYDKPLQIEGYEFVVHKNEYSSSPVYFQIYSSNQAIFESTVLPNLHISQANVATPLIKIE
KNQSFISSLVSFNEVSSALMAYDKPLQIEGYEFVVHKNEYSSSPVYFQIYSSNQAIFESTVLPNLHISQANVATPLIKIE

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YTDNVPQRAFKYADALAESFISDSVKDKSGKNSKVIDFIDTQLISVKDKLKSTEEQLEEYQAKNNLVQPSIQADTLIKEL
YTDNVPQRAFKYADALAES                                                             

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSLDIKNSENQYRDRLIDSLSDFVSQDRQIDSIAPSLMELNDQPTLSLINQLQQEQLKLDALSVEYTPQHPDVLKAKELV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAIRKKILQNVKTLKYSSVQKTKNLNELKLKYESMLQGLPNQEKNLINLKRDYEVNSNMYEYLLKKKSENEIIQVSVVSD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YKKIGQTYLQSEPVAPKRGFILLISLFLGLIVGILLAVLRYFINDKIQGKTDIENASRLPIYGIIPTEKGEVGIEVFKSA


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSPFSESFRSLRTNLQFALKSDDANVILITSSISGEGKTTVSANLASIFQITNFKTVVIDLDMRKPSLHKLFGVANAKGM
                             TSSISGEGKTTVSANLASIFQITNFKTVVIDLDMRKPSLHKLFGVANAKGM
                                    GKT                 VVIDLDMR                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STYLSYRSELHEIINKTKYPFLDLITAGPIPPNPSELVFVKRLELLIKELKNRYEFIIIDTSPIGMVNDSFTLMKYSDIN
STYLSYRSELHEIINKTKYPFLDLITAGPIPPNPSELVFVKRLELLIKELKNRYEFIIIDTSPIGMVNDSFTLMKYSDIN
                                                        IIIDTSP                 
       730       740       750       760       770      
....:....|....:....|....:....|....:....|....:....|....:.
LMVFRENFTKKDFVSSLDRAIKEQHVGKIGIILNGSKVKGSSGYGYGYGYGAEGNG
LMVFRENFTKKDFVSSLDRAIKEQHVGKIGIILNGSKVKGSSGYGYGYGYGAEGNG
                                           YGYGYGY      

© 1998-2019