BYKdb

Annotate results for A0A0C4WSI1

A0A0C4WSI1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0C4WSI1
DOMAINtad15/267AGIDLRKLLGALLDHKWPIIGVTALFCLGGALYGMFATPIYRTTALVQIEKKSGTVPGLE
MGGDVNAQASSARTEIELLRSRSVIGQAVDNLHLDVRATPQRFPLIGDYLARRHRGPGLA
EPFLGLEEYAWGGEKIEVLRFDVEPQWAGKRLVLTAADNGAFSLQDGEGRPLLQGRVGEA
IDQQGIRLQIHELQARPGTRFTLSKGSRLSTIRTYRGALQLTEVGGDTGLITVAMNHPDP
RHASRVVDEISRL
DOMAINcd547/737SGPGPQAGKSFVCANLAAVVAQTGKRVLLVDVDMRKGQLHRLLGMEEAGTGLSDLLEGRC
DLADAIRPTPVEGLFLLSRGQIPPNPSERLMHPNFSAVLQQASASHDLVILDTPPLLAVT
DAAIVGRQAATTLIVARFGVSSAREIELTVRRFAQNGIEIKGAIFNGMEKRAATYGYGHA
AYYHYEYKPDN
SITEWalker A554/556GKS
SITEWalker A'574/581LLVDVDMR
SITEWalker B655/661VILDTPP
SITEY Cluster721/733YGYGHAAYYHYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MYPTSAPHQQEHDDAGIDLRKLLGALLDHKWPIIGVTALFCLGGALYGMFATPIYRTTALVQIEKKSGTVPGLEMGGDVN
              AGIDLRKLLGALLDHKWPIIGVTALFCLGGALYGMFATPIYRTTALVQIEKKSGTVPGLEMGGDVN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQASSARTEIELLRSRSVIGQAVDNLHLDVRATPQRFPLIGDYLARRHRGPGLAEPFLGLEEYAWGGEKIEVLRFDVEPQ
AQASSARTEIELLRSRSVIGQAVDNLHLDVRATPQRFPLIGDYLARRHRGPGLAEPFLGLEEYAWGGEKIEVLRFDVEPQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WAGKRLVLTAADNGAFSLQDGEGRPLLQGRVGEAIDQQGIRLQIHELQARPGTRFTLSKGSRLSTIRTYRGALQLTEVGG
WAGKRLVLTAADNGAFSLQDGEGRPLLQGRVGEAIDQQGIRLQIHELQARPGTRFTLSKGSRLSTIRTYRGALQLTEVGG

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTGLITVAMNHPDPRHASRVVDEISRLFVRQNVERMSAEVDGSLKFLRTQLPEVRRDLEKAEDALNDYRKRHGSVDIGME
DTGLITVAMNHPDPRHASRVVDEISRL                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGTVLNQAVGLETRLSELRMQQAELDRRFTREHPAYKTLLMQIQGLTQRKNEIARRMQGLPETQQELLRLSRDVQVGTAI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YTQLLNRAQEIDLVRAATIGNVRIVDQAVIEGGTVAPDKTLILLVATLVGALLAIGVVLLRKLLNPGLETPEAIEQLGLP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VYAAVPFSEHQAHFKPRRRRAAGSPAQVSPLLALGQPHDPAVEALRSLRTSLHFIMLGAQDNRLAISGPGPQAGKSFVCA
                                                                  SGPGPQAGKSFVCA
                                                                         GKS    
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLAAVVAQTGKRVLLVDVDMRKGQLHRLLGMEEAGTGLSDLLEGRCDLADAIRPTPVEGLFLLSRGQIPPNPSERLMHPN
NLAAVVAQTGKRVLLVDVDMRKGQLHRLLGMEEAGTGLSDLLEGRCDLADAIRPTPVEGLFLLSRGQIPPNPSERLMHPN
             LLVDVDMR                                                           
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FSAVLQQASASHDLVILDTPPLLAVTDAAIVGRQAATTLIVARFGVSSAREIELTVRRFAQNGIEIKGAIFNGMEKRAAT
FSAVLQQASASHDLVILDTPPLLAVTDAAIVGRQAATTLIVARFGVSSAREIELTVRRFAQNGIEIKGAIFNGMEKRAAT
              VILDTPP                                                           
       730        
....:....|....:...
YGYGHAAYYHYEYKPDNA
YGYGHAAYYHYEYKPDN 
YGYGHAAYYHYEY     

© 1998-2019